KEGG   Vibrio cholerae O1 O395: VC395_2118Help
Entry
VC395_2118        CDS       T02099                                 

Gene name
rrmA
Definition
(GenBank) rRNA (guanine-N1-)-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
vcr  Vibrio cholerae O1 O395
Brite
KEGG Orthology (KO) [BR:vcr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:vcr03009]
    VC395_2118 (rrmA)
Enzymes [BR:vcr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     VC395_2118 (rrmA)
Ribosome biogenesis [BR:vcr03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    VC395_2118 (rrmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_31 Methyltransf_11 Methyltransf_32 Methyltransf_23 Methyltransf_12 Ubie_methyltran MTS PCMT DUF938 CMAS Methyltransf_33 FtsJ CheR Methyltransf_4 Methyltransf_29
Motif
Other DBs
NCBI-ProteinID: ACP10110
Position
I:2240385..2241221
Genome map
AA seq 278 aa AA seqDB search
MLIETTMTFLCPLCEHPLTLNQNTYACINRHQFDVAKEGYVNLMPVQHKRSKDPGDNKEM
TQARRRFLHTGHYAPMREKVATLCQTYLTDRQQTLLDIGCGEGYYTDFFAKALRQQDSEA
QIFGLDISKIAIRYAAKRYPECQFAVASSHRLPFANQSLDGVIRIYAPCKDTELERCIKI
GGIVITVTPAARHLYQFKQGIYDQVRLHEEQPETLSGFELVEECKLHYPMALNGSEAADL
LQMTPFAWRASEDFKHRVSQSDTFECEADFMLRVYRRK
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
ttgttgattgagaccaccatgacctttttgtgcccgctgtgtgagcatcccctaacgcta
aaccaaaatacttacgcctgtatcaatcgtcatcaatttgatgtagcgaaagaggggtac
gtcaatctgatgcctgttcagcataagcgctccaaagatcccggtgataacaaagagatg
acacaggctcgtcgccgttttttacacacaggccactacgcgcccatgcgtgaaaaagtt
gccacattgtgccaaacctatttaacggaccgccagcaaacgctgctcgatattggttgc
ggtgaaggctactacaccgatttttttgccaaggctttgcgccagcaagacagtgaagca
caaatttttgggctcgatatttccaaaatcgccatacgctacgcggccaaacgctaccca
gagtgccagtttgccgtagcctctagccaccgcttaccttttgccaatcagagtctggat
ggcgtgatccgtatttacgcaccatgcaaagacaccgaattggagcgttgtatcaaaata
ggcggcatcgttatcaccgtcacgccagcggcacgtcacctgtatcaatttaaacaaggc
atctacgatcaggtgcgtttacatgaagagcaaccagaaactctgtcgggttttgaattg
gttgaagagtgtaaactccactaccctatggcactcaatggctcagaagcggcagacttg
ctgcaaatgactccgtttgcttggcgtgccagtgaggattttaaacaccgtgttagtcaa
agtgatactttcgaatgtgaagccgattttatgctccgagtgtatcgcagaaaataa

DBGET integrated database retrieval system