KEGG   Vibrio cholerae O1 O395: VC395_A0102
Entry
VC395_A0102       CDS       T02099                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11905  type VI secretion system protein
Organism
vcr  Vibrio cholerae O1 O395
Brite
KEGG Orthology (KO) [BR:vcr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcr02044]
    VC395_A0102
Secretion system [BR:vcr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VC395_A0102
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: ACP10948
Position
II:118906..119331
AA seq 141 aa
MTYIAPEESAFGVGFFERLEANAKPMSLTRGPDAWDVLESIKRNVSNILNTRIGGAQSAP
HLGLVDFNDATLETLDLSVRIKLAIQQCLERYEPRLTRADQDSFNSLTLRFHITATINSE
ALHEKVQFSLLLDQSRKYRVF
NT seq 426 nt   +upstreamnt  +downstreamnt
atgacgtacatcgcacctgaagagagtgcatttggtgttggctttttcgaacgtttggaa
gccaacgccaaacctatgtcgctgacccgtgggccagacgcgtgggatgtactcgaatcg
atcaaacggaatgtctctaacattctgaacactcgaattggtggagcgcaaagtgcccct
catctcgggttggtggattttaatgatgcaacgctggaaaccttagatctctccgtgcga
attaaattggcgattcaacagtgccttgagcgctatgagccgcgtttaactcgagcggat
caagatagctttaactcgctgactttaaggttccacattaccgcgaccatcaatagcgaa
gcgttacacgaaaaagtccagttcagtctgttattggatcaaagcagaaaatatcgagtg
ttttaa

DBGET integrated database retrieval system