KEGG   Vibrio cholerae O1 O395: VC395_A0106Help
Entry
VC395_A0106       CDS       T02099                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
vcr  Vibrio cholerae O1 O395
Pathway
vcr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vcr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VC395_A0106
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcr02044]
    VC395_A0106
Secretion system [BR:vcr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VC395_A0106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS-SciN LPAM_1
Motif
Other DBs
NCBI-ProteinID: ACP10952
Position
II:123579..124055
Genome map
AA seq 158 aa AA seqDB search
MNKVLWMLFALTVLTACSSSDKYEPAKEPTKVTFSLVSDEGVNPNIWGEASPIEIQVFEL
KDDSMFMSSDYDQIKTDYKKALRSNFVKNYDYVLTPGQFKFVNAFEVDEETNYIGVMAHF
AEPELSEWKKAVKVINKGREYHLLMLFKDYDVKLDRVE
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaaagtgctgtggatgctgtttgccttgacggtgctgaccgcgtgcagttcgtcg
gataagtacgagcctgcgaaagagccgaccaaggtgacttttagcttagtcagcgatgaa
ggggtgaacccgaacatctggggtgaagcgtcaccgatagaaattcaagtttttgagcta
aaggatgactcgatgtttatgtcgtccgactacgaccagatcaaaaccgattataaaaaa
gcgctgcgcagtaactttgttaaaaactacgactatgtactgactccagggcagttcaaa
ttcgtcaacgctttcgaagtcgatgaggagaccaactacatcggcgtgatggctcatttt
gccgagcctgaactcagcgaatggaagaaagcggtcaaggtgatcaataaagggcgagag
tatcacttgctgatgctgtttaaagactacgatgtgaaattggatagggtggaataa

DBGET integrated database retrieval system