KEGG   Vibrio cholerae O1 O395: VC395_A0108
Entry
VC395_A0108       CDS       T02099                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
vcr  Vibrio cholerae O1 O395
Pathway
vcr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vcr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VC395_A0108
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcr02044]
    VC395_A0108
Secretion system [BR:vcr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VC395_A0108
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: ACP10953
Structure
PDB: 
4V3I

Position
II:125401..126174
AA seq 257 aa
MSQSKKETPLASLLFDDVEKINHDQDYWFQLRGDNPNVLIDAATPLFGLSLRVRTLTECD
NIEQIYRQTIEEIKAIEIELTEQGYEHAILMAYRYILCAFLDESVMGTEWGASSLWAEHS
MLSRFHNETWGGEKVFTILSRLEGEPHRYQALLAFIYHCLILGFEGKYRVMEGGQAEREK
VISRLHQLLSSLEESEPQDLTRPTDHVVRAKYTLSRQMPVWSVFAGFIVLWVGLFLGYSY
VLHSKSSDVLNQLNQIL
NT seq 774 nt   +upstreamnt  +downstreamnt
atgtcacagagtaaaaaagagacgccattagccagtttgttgttcgacgatgtggaaaaa
attaaccacgaccaagactactggttccaattgcgtggggacaatccgaatgtgctgatt
gatgccgcgacacccttgtttgggctttctctgcgggttcgtaccctcaccgaatgcgac
aacattgaacagatctaccgtcagacgattgaagagatcaaagcgattgaaattgagttg
acggagcaaggttacgaacacgccattttgatggcctatcgctacatcttgtgcgccttt
ttggatgaatccgtgatgggaaccgagtggggcgcgtccagtttatgggccgagcactcc
atgctgtcacgcttccataatgaaacgtggggtggcgagaaagtgtttacgattttgagc
cgtcttgagggtgaaccacaccgttaccaagcgctattggcctttatttatcattgcctg
attttgggctttgaaggcaaataccgtgtgatggaagggggacaagctgagcgcgaaaaa
gtgatcagccgcctgcatcaactgctgagcagcttggaagagagcgagccacaagactta
acccgtccgaccgatcatgtggtgcgtgcgaaatataccctaagcagacagatgcctgtt
tggtctgtgtttgctggctttatcgtgctttgggtaggtctatttctcggctacagctat
gtactgcatagcaaatccagcgatgtgctcaatcaactcaatcaaatactttaa

DBGET integrated database retrieval system