KEGG   Vibrio cholerae O1 O395: VC395_A0111
Entry
VC395_A0111       CDS       T02099                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11909  type VI secretion system protein VasI
Organism
vcr  Vibrio cholerae O1 O395
Brite
KEGG Orthology (KO) [BR:vcr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcr02044]
    VC395_A0111
Secretion system [BR:vcr02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   VC395_A0111
SSDB
Motif
Pfam: VasI DUF2826
Other DBs
NCBI-ProteinID: ACP10956
Position
II:130374..131057
AA seq 227 aa
MPEIGDQNPMRITVLVVSLILGCAGSAHVLAASQDAGSQVEQAELCREIPARLERLACFD
RVFATPLEQVAIAPSNPYPAEWQRAMVALSESQSEAGWVLGTQGEGRGSSAWIALPAQNR
SSGETSPPVLLLSCINNLSRIELALPKEVADARIQVSIRHETQFWRSDDHGVLFSSARGM
PAIEMMKLAASESRLLLRSNAPFADGLQFDTRGVNEALDALRERCGW
NT seq 684 nt   +upstreamnt  +downstreamnt
gtgcctgaaattggagatcaaaaccccatgagaattaccgttttagtggtcagtttgatc
ttgggttgcgcgggctctgcgcatgttttagcagcatcgcaagatgcgggctcacaggtt
gagcaagctgagctgtgccgcgaaattcctgcgcgtttagagcgtttggcttgttttgac
cgtgtctttgccacgccccttgagcaagtggctatcgcaccgtccaatccttatcccgca
gagtggcaacgcgccatggtggcattgtctgagtcgcagtccgaagcgggttgggtatta
ggtacgcaaggtgaagggcggggcagcagcgcttggattgctttgcctgcgcaaaatcgc
agctcaggggaaacatctccgccagtgctcttgctcagttgcattaataacctgagccgc
attgagctggctttaccgaaagaagtggctgatgcacggattcaagtctctatccgacac
gagacacagttctggcgcagtgacgatcacggcgtactgttttcctcggctcgcggcatg
cctgcgatcgaaatgatgaaattggccgccagtgagtctcgcctgttgctgcgttctaat
gcgccctttgctgacgggttacagtttgatactcgaggtgtcaatgaagcccttgatgct
ttgcgcgaacgctgtggttggtaa

DBGET integrated database retrieval system