KEGG   Vibrio cholerae O1 O395: VC395_A0114
Entry
VC395_A0114       CDS       T02099                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11911  type VI secretion system protein VasL
Organism
vcr  Vibrio cholerae O1 O395
Brite
KEGG Orthology (KO) [BR:vcr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcr02044]
    VC395_A0114
Secretion system [BR:vcr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VC395_A0114
SSDB
Motif
Pfam: ImpA_N Cytochrom_B562
Other DBs
NCBI-ProteinID: ACP10958
Position
II:136077..137342
AA seq 421 aa
MMSNVIFIDNVCYRLTNDSEEIRGLEPYAKVREEINRRFNPIAGGTDWAVVKEYCEQLAC
NQGMDFLICGYYAVACLKTQGLAGYATGMELMSASLANQGECDVKSAKVRKEILDWVNAR
VVQELKALKPTYESLRDLYRAERHCERLHQLFEQQQTEYKVDFEGVGFALFEHIDRIETQ
YHSLLKKQEKAQPPKLKFWQRGYALFTLGVLGVALGMVGGYWGWPWFYTTPYAAPQRITT
LNEASQTQALLNDSSTSERARWQHDLIPLYRDTLQQNLTISFSEPKRHAITQLNLLRTLY
PENEQVNALSQEFALQQQQALEQTALFVAKFSEIRTKMANISLLAKRGKWAELEKQTKSL
EEFAVSLSPIYGRVDYVQGLLEQGDVTNAQKEFAILKQRLDSLSWKIAELEQRIGDAALL
Q
NT seq 1266 nt   +upstreamnt  +downstreamnt
gtgatgtccaatgtgatttttattgataacgtttgctaccgattaaccaatgattctgag
gagattcgcggattagagccctatgcgaaggttcgtgaggagataaaccgccgcttcaat
ccgattgctgggggcacggattgggcagtggtaaaagagtactgtgaacaactggcctgt
aaccaaggaatggattttctgatctgcggttactatgcggtagcctgcctgaaaactcag
gggttagcggggtatgccaccggtatggagctgatgagtgcaagccttgccaaccaaggt
gagtgtgatgtgaaaagcgccaaagtgcgcaaagagatccttgattgggtcaatgcacgt
gtggtgcaggaactgaaagcacttaagccaacttatgagtcgctgcgagatctgtatcgg
gctgagcgccattgcgagcggttacatcagctgtttgaacagcaacaaaccgaatacaaa
gtagactttgaaggggtcgggtttgctctgtttgaacacatagacagaattgaaacccaa
taccacagcttattgaaaaagcaggagaaggctcagccacctaagcttaagttttggcag
cgcggttacgcgttgttcactctaggtgtactcggggttgcactgggaatggtggggggc
tactgggggtggccttggttttataccacgccttatgccgcgccacagcgcatcactacg
ttgaatgaggcctctcaaactcaagcactgctcaacgactcttccacaagtgagcgtgcg
cgttggcaacatgatctgatcccgctgtatcgcgatactttgcagcagaatttaaccatc
tcgtttagtgaacctaagcgacatgccatcactcagctgaatctattgcgcactctttat
cctgaaaacgagcaagtgaatgcactgagtcaagagtttgcccttcagcagcaacaagcg
ttggagcaaaccgcgctgttcgtggctaagttcagcgaaattcgcaccaaaatggccaat
atctcgttattggctaagcgagggaaatgggctgagttagaaaagcagaccaaatcatta
gaagagttcgcggtcagcctatcaccgatttatggtcgagttgactatgtgcaaggcctc
cttgaacagggcgatgtcacaaatgcccagaaagagtttgcgatcctcaaacaaaggcta
gatagcctaagttggaaaattgccgagcttgagcagcgtatcggcgatgcggctttgttg
cagtga

DBGET integrated database retrieval system