KEGG   Vibrio cholerae O1 O395: VC395_A0622Help
Entry
VC395_A0622       CDS       T02099                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vcr  Vibrio cholerae O1 O395
Pathway
vcr00071  Fatty acid degradation
vcr00280  Valine, leucine and isoleucine degradation
vcr00310  Lysine degradation
vcr00362  Benzoate degradation
vcr00380  Tryptophan metabolism
vcr00620  Pyruvate metabolism
vcr00630  Glyoxylate and dicarboxylate metabolism
vcr00640  Propanoate metabolism
vcr00650  Butanoate metabolism
vcr00900  Terpenoid backbone biosynthesis
vcr01100  Metabolic pathways
vcr01110  Biosynthesis of secondary metabolites
vcr01120  Microbial metabolism in diverse environments
vcr01130  Biosynthesis of antibiotics
vcr01200  Carbon metabolism
vcr01212  Fatty acid metabolism
vcr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vcr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VC395_A0622
   00630 Glyoxylate and dicarboxylate metabolism
    VC395_A0622
   00640 Propanoate metabolism
    VC395_A0622
   00650 Butanoate metabolism
    VC395_A0622
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VC395_A0622
   00072 Synthesis and degradation of ketone bodies
    VC395_A0622
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VC395_A0622
   00310 Lysine degradation
    VC395_A0622
   00380 Tryptophan metabolism
    VC395_A0622
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VC395_A0622
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VC395_A0622
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VC395_A0622
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vcr04147]
    VC395_A0622
Enzymes [BR:vcr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VC395_A0622
Exosome [BR:vcr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VC395_A0622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACP11456
Position
II:574125..575330
Genome map
AA seq 401 aa AA seqDB search
MEKIYIVGAKRSAIGAFGGSLKECSAGALAGQVIQAALEAAQVKPEAVDEVIVGNVVSAG
QGMGVGRQAALVAGVPQSVPAYSINMVCGSGMKSVMDGVAHIKAGDASVVVAAGVEVMSQ
IPFVTPASLRDGQKMGAFEVKDLLIHDGLTDVFNQYHMGVTAENIAKQYDIARQTQDEFA
LASQMKATAAIEAGHFKREIVPISVKKRRETVVFDTDEYPKPTTTLAALQGLRAAFDAQG
TVTAGNASGINDGASAVIIASESAVKKLGLTPIAEIMSYAQTGLDPKVMGLGPVSAVTQA
LAKAELSITQVDLFELNEAFAAQALGVVYGLADQHAIQPEAILEKANVNGGAIALGHPLG
ASGNRILVTLLHELQRRQKHYGVASLCVGGGMGTAIVIKTV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagatctatatcgtgggagcaaagcgctcagctatcggagcctttggtggttca
cttaaagagtgttcggcaggcgctttggcaggacaagtcatccaagccgctcttgaagcc
gcacaagtcaaacctgaagctgtcgatgaagtgattgttggtaacgttgtgagtgccgga
caaggcatgggtgttgggcgtcaagcggctttagtggctggtgttccacagtcggttcca
gcttacagcatcaacatggtgtgtggcagtgggatgaaatcggtgatggatggggttgcg
cacatcaaagcgggagatgcttctgtcgttgtggccgctggtgttgaggtcatgtcacaa
atcccatttgttacgcctgccagcttacgagatgggcagaaaatgggcgcgtttgaagtg
aaagatctgctcatccatgacggtctgaccgatgtcttcaatcaataccacatgggtgtg
acggcagaaaatatcgctaaacagtacgacatcgctcgtcaaacacaagatgagtttgcg
ttggccagccaaatgaaagcgacagcggccattgaagccggacattttaagcgagaaatt
gtgcctatttcggtcaaaaaacgccgtgaaaccgtcgtgtttgatacggatgaataccct
aaaccgacgaccacgttggcagcattgcaaggcttacgcgccgccttcgatgcacaaggt
acggttaccgcaggtaatgcttctggaattaacgatggtgccagtgcggtgattatcgcc
agcgaaagtgcggtaaaaaaactaggcttaacccctatcgcagaaattatgagttatgca
caaacagggttggatccgaaagtcatgggcttagggcctgtgagtgcagtcactcaagca
ttagcgaaagcagaattatctatcactcaggttgatctgtttgaacttaacgaagcgttt
gccgctcaagcattaggtgtcgtttacggtttagctgatcaacacgcgattcaacctgag
gcgattttagaaaaagccaacgtcaatggcggtgccattgcgttagggcatccactaggg
gcatcgggtaaccgcattctggttactctgcttcatgaattacagcgtcgccaaaaacat
tatggcgtcgcttcactctgcgtcggcggtggcatgggcaccgcgatcgtgattaaaaca
gtttaa

DBGET integrated database retrieval system