KEGG   Vibrio cholerae O1 El Tor MS6: MS6_0295Help
Entry
MS6_0295          CDS       T03666                                 

Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
vcs  Vibrio cholerae O1 El Tor MS6
Brite
KEGG Orthology (KO) [BR:vcs00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    MS6_0295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: BAP01950
Structure
PDB: 

Position
1:complement(348373..348753)
Genome map
AA seq 126 aa AA seqDB search
MDVSLPCIKIQVQTRYIEEQSNPEYQRFVFAYLITIKNLSSQTVQLMSRRWLITDADGKQ
TVVEGDGVVGEQPRIKANDEYTYSSGTALDTPVGVMQGQYLMIDEQGESFTVEIEPFRLA
VPHVLN
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggatgtttcgctgccctgtatcaaaattcaggttcaaactcgctacattgaggaacaa
tcaaatcctgagtatcagcgctttgtgttcgcctatctcatcaccatcaaaaatctcagc
tcccagaccgtccaactgatgagtcggcgctggttgatcacggatgccgatggcaaacag
accgtggttgaaggcgatggcgttgtgggagagcaacctcgcatcaaagctaacgatgaa
tatacctacagcagtggcacggccttagatactcccgtcggtgtgatgcaggggcaatat
ttgatgatcgatgaacaaggtgagtctttcacggttgagattgaaccatttcgtttagcc
gttccgcatgtattgaattaa

DBGET integrated database retrieval system