KEGG   Vibrio cholerae O1 El Tor MS6: MS6_A1076Help
Entry
MS6_A1076         CDS       T03666                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
vcs  Vibrio cholerae O1 El Tor MS6
Pathway
vcs00051  Fructose and mannose metabolism
vcs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MS6_A1076
Enzymes [BR:vcs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     MS6_A1076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: BAP05335
Position
2:1012023..1013177
Genome map
AA seq 384 aa AA seqDB search
MKKNAVHFGAGNIGRGFIGKLLADADIAVTFADVNEPLVDQLSHQQEYKVKVVGSECKME
TVSHVTAVNSASEALIERIIKTDLVTTAVGPTVLDIIAKTIAKGLSARFAAGNTQPLNII
ACENMVRGTTHLKQQVYQFLTTEEQQQADALVGFVDSAVDRIVPPLQAANDDPLEVTVES
FSEWIVDEQQFKGEIPQIEGMEKTDNLMAFVERKLFTLNTGHCVTAYLGCLKGHRTIREA
IEDPCIHAQVKQAMQESGEVLIRRYGFDRALHSAYIEKILSRFANPYLVDEVDRVGRQPL
RKLSANDRLIKPLLGTIEYGLPNGMLLKGIAAALKYRNSSDPQAVELQQSIEKEGVRSTL
ARYTGLAAESVEAQQIEALYQQMD
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaatgcagttcattttggtgctggcaacattggccgtggctttattggcaaa
cttctggcggatgccgacattgccgtcaccttcgccgatgtcaacgaaccccttgtggat
caactgagtcatcaacaagaatacaaagtcaaagtggtcggtagcgaatgcaaaatggaa
accgttagccacgtcaccgccgtcaacagtgctagtgaagccttgatcgagcggattatc
aaaaccgatttagtcaccacggcggttgggccaacagtgctggatatcattgccaaaacc
atcgccaagggtttgagcgctcgctttgccgcaggtaatacgcaaccactcaacatcatc
gcctgtgagaatatggtgcgcggtacgactcaccttaagcagcaggtgtatcaattcctc
actaccgaggaacaacaacaagctgatgctttagtgggctttgtggattccgcagtcgat
cgcattgtgccaccgttgcaagcagctaacgacgatccgttggaagtgaccgtagaaagc
ttcagcgaatggattgtggatgagcagcagtttaaaggcgagatcccacagattgaggga
atggagaaaaccgataacctgatggcgtttgtcgaacgcaaactgtttaccctcaacacg
ggtcactgtgtgacggcttatctgggctgtttaaaaggtcaccgtaccatccgtgaagcg
attgaagatccgtgcattcatgcacaggtgaaacaagcgatgcaagagagcggcgaagtg
ctgatccgccgctatggttttgatcgcgccctgcacagcgcctacatcgagaaaatccta
agccgctttgccaatccttatctggtggatgaagtggatcgcgttggtcgtcagccgctg
agaaaacttagcgcaaatgatagattaatcaaacctttactcggtacaattgagtacggc
ttaccaaacggcatgttattgaaagggattgccgcagcgctgaaatatcgcaatagcagt
gatccccaagccgtcgaattacaacaaagtattgaaaaagaaggtgttcgctctacactt
gcccgctataccgggttagccgccgaaagtgtggaagcacaacaaattgaagctctctac
caacagatggattga

DBGET integrated database retrieval system