KEGG   Vibrio coralliilyticus OCN014: JV59_19605Help
Entry
JV59_19605        CDS       T03497                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vct  Vibrio coralliilyticus OCN014
Pathway
vct00071  Fatty acid degradation
vct00072  Synthesis and degradation of ketone bodies
vct00280  Valine, leucine and isoleucine degradation
vct00310  Lysine degradation
vct00362  Benzoate degradation
vct00380  Tryptophan metabolism
vct00620  Pyruvate metabolism
vct00630  Glyoxylate and dicarboxylate metabolism
vct00640  Propanoate metabolism
vct00650  Butanoate metabolism
vct00900  Terpenoid backbone biosynthesis
vct01100  Metabolic pathways
vct01110  Biosynthesis of secondary metabolites
vct01120  Microbial metabolism in diverse environments
vct01130  Biosynthesis of antibiotics
vct01200  Carbon metabolism
vct01212  Fatty acid metabolism
vct02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    JV59_19605
   00630 Glyoxylate and dicarboxylate metabolism
    JV59_19605
   00640 Propanoate metabolism
    JV59_19605
   00650 Butanoate metabolism
    JV59_19605
  09103 Lipid metabolism
   00071 Fatty acid degradation
    JV59_19605
   00072 Synthesis and degradation of ketone bodies
    JV59_19605
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    JV59_19605
   00310 Lysine degradation
    JV59_19605
   00380 Tryptophan metabolism
    JV59_19605
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    JV59_19605
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    JV59_19605
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    JV59_19605
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vct04147]
    JV59_19605
Enzymes [BR:vct01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     JV59_19605
Exosome [BR:vct04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   JV59_19605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIS57237
Position
2:complement(820072..821280)
Genome map
AA seq 402 aa AA seqDB search
MEKVYIVAAKRTPIGSFGGTLKDISAGNLGSIAIKAALEQGKVAPELVDEVIVGNVVGAG
QGMGIGRQAAIYAGIPESVPAYTLNMVCGSGMKTVMDAVSHIRSGDASVVVAAGVEVMSQ
IPFTVSSNIRDGHKMGNMNLTDLLINDGLTDVFNQYHMGKTAENVAREVGINREQQDEYA
LASQMKAVAAIEAGKFVDEIVAVDVKKRKETIVFDTDEYPKANATLSGLEKLRPAFEKEG
TVTAGNASGINDGASAIIVASESAVQKHGLQPIAEIASYAQSGLNPEIMGLGPVEAVTQA
LSKAEITTDDVNVYELNEAFAAQALGVIHKLAQEHDVSVSSILDKANVNGGAIALGHPLG
ASGNRILVSLVHELNRSNGTYGVASLCVGGGMGTAVVLKSIA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagtttatattgttgcagctaagcgcacgccaattggttcatttggcggaacg
ttaaaagacatttcagcaggaaatctaggctcaattgcgattaaagccgctttggagcaa
ggtaaagttgcccctgagctggttgacgaagttatcgttggtaacgtcgtaggcgccgga
caaggcatgggtattggtcgtcaggcggctatctatgctggtattccagaatctgtacct
gcgtacacacttaatatggtgtgtggcagtggcatgaaaacagttatggacgcagtcagc
cacatccgctctggtgacgcttcagtagtcgttgccgcaggcgtagaagtgatgtcccag
attcctttcactgtgtctagcaacattcgtgacggccacaagatgggcaacatgaatcta
accgatcttctcatcaacgatgggttaactgatgttttcaaccaataccatatgggcaaa
acagcagaaaacgttgctcgtgaagtaggaatcaaccgtgaacaacaagatgaatacgca
cttgcaagccaaatgaaagccgttgcggcgattgaggcaggtaagtttgttgatgaaatc
gttgctgttgacgtgaaaaaacgtaaagaaacgattgtgtttgacacggatgaatatcca
aaagcgaatgcaacgttgagcggtttagaaaagctacgtcctgctttcgaaaaagaaggc
actgttactgctggtaatgcgtctggtattaacgacggtgcgagcgcgattattgttgcg
agcgaaagcgcggttcagaagcatggtttgcaacctattgctgagattgcaagttacgcg
cagtctggcctaaacccggaaattatggggttgggtccggtagaagctgtgactcaagca
ctgagcaaagcagaaatcacaacagacgacgtcaatgtttatgaattgaatgaagcgttt
gctgctcaagcactcggtgtcatccataagctagcacaagaacacgatgtatccgtttct
tcgattttagataaagccaatgtaaatggcggtgcgattgctcttggtcaccctctaggt
gcatcaggtaaccgtattttggtttcccttgttcacgaacttaacagaagtaacggtact
tatggtgtcgcttcactatgtgttggtggcggtatgggaactgcagtagttcttaaatca
atcgcttaa

DBGET integrated database retrieval system