KEGG   Vibrio coralliilyticus OCN014: JV59_22775Help
Entry
JV59_22775        CDS       T03497                                 

Definition
(GenBank) beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
vct  Vibrio coralliilyticus OCN014
Pathway
vct00511  Other glycan degradation
vct00520  Amino sugar and nucleotide sugar metabolism
vct01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    JV59_22775
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    JV59_22775
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:vct03110]
    JV59_22775
Enzymes [BR:vct01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     JV59_22775
Chaperones and folding catalysts [BR:vct03110]
 Intramolecular chaperones
  Others
   JV59_22775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b Glycohydro_20b2 NigD_N
Motif
Other DBs
NCBI-ProteinID: AIS57803
Position
2:complement(1569816..1572266)
Genome map
AA seq 816 aa AA seqDB search
MKKATLALVIPGLMAAPMTMAMAPNTDLNLMPYPQTVELGEGKVAIDKSFSIYIKGYDSE
RVQFNAKRTVDRLYRQTGLPMLHWQAESEDKATLVIDISKASKDEVQNAESDESYQLSIK
DGQIRIDSERPYGALHGLETFLQLVTTDASGYFVPSVEIEDEPRFKWRGVSYDTARHFVE
LDVILRQLDAMASAKMNVFHWHIWDDQGIRIQLDNYQKLWQETADGDYYTKDEIRYVVNY
ARNLGIRVIPEISLPGHASAVAHAYPELMSGLGEQSYPQQRGWGVFEPLMDPTNPELYKM
LASVFDEVVELFPDEYFHIGGDEPDYKQWQENPRIQQFIADNELDGERGLQSYLNTKVEK
MLEERGKKMTGWDEIWHKDLPTSIVIQSWRGHDSIGRAAKQGYQGVLSTGYYLDQPQPTS
YHYRNDPMPSGITVDDKLHQGEKFATYDWVKPRNKGGPRKGNLTIIEAADGSFRAFTDYN
GKSRQEVHILEYVPGVKFRGHFDNFMSYTEFNYEFAGGKLKEGSYQLIGNVRWPATGELV
ASSDVKGSVIPAPNGGYPAVLEGDEKDLILGGEITVWGENLDSTTIEHRLWPRSYAIAER
LWSSQELTDERSMYQRMKVMDTWSEISLGLRHHADANMMLKRLANGADVAPLQTLSNYIE
PAQYYARHWEKWISTPNKGDLYNKYERLNRFADALPMESLTVYEMNDLVEAFAKGDTLAL
DKLELHYQTAKLAAQQAKPIFAANVASVDTVVVSDATVRVSELALTLIEAAKQGQTLRAS
DVAEYQRIIDDNAIILDETIVAIVKPTEMLLHKLAN
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagctacattagcactggttattcctggtttaatggcggcccctatgacaatg
gctatggctccaaacacagaccttaatctgatgccttatcctcaaacagtggaattgggc
gagggcaaggtcgcaatcgacaaatctttcagcatttacatcaaaggctatgattctgaa
cgtgttcagttcaacgccaaacgaacggtggatcgcctctatcgtcagacgggtttgcca
atgctccactggcaagctgaatcggaagacaaggctaccttagtgatcgatatcagtaag
gcatcgaaagacgaagtacagaacgctgagagtgatgagtcttatcagctgtcgatcaaa
gatggccaaatccgtattgactccgagcgcccgtatggtgctttacatggtctggagacg
tttctacaactggtgaccacagacgcctccggttactttgtaccgagtgtagagatcgag
gatgaaccgcgcttcaaatggcgtggtgtctcttacgacactgcgcgtcactttgttgaa
ttggacgtgattctgcgtcaacttgatgcaatggcatccgcgaagatgaacgtcttccac
tggcatatctgggatgaccaagggattcgcattcagctcgataactaccagaaactgtgg
caagagacggccgacggtgattactacaccaaagacgaaatccgttatgtggtgaattac
gcgcgcaaccttggtattcgtgtcattcctgaaatttccctgccgggtcatgcttctgct
gtcgcgcatgcctatcctgaactcatgtctggccttggtgagcaatcctacccgcagcaa
cgtggctggggtgtgtttgaaccgctgatggatccaaccaacccagagctatacaagatg
ttggccagtgtattcgatgaagtggttgaactgttcccagacgagtacttccacatcggt
ggtgatgagccggattataaacagtggcaagaaaacccacgcatccagcagtttatcgct
gacaacgagctggatggtgaacgtggcctgcaatcttacctcaacaccaaagttgaaaaa
atgcttgaagagcgtggtaagaagatgacgggctgggatgagatctggcataaagatctg
cctacatcgattgtcatccagagctggcgtggtcacgacagcattggccgcgcggcgaag
cagggctatcagggtgtgctttcgaccggctactatctggatcaaccacagccgaccagc
taccactatcgcaatgacccaatgccaagcggcatcaccgttgacgacaagttacatcaa
ggtgaaaagtttgccacctatgactgggttaaaccacgtaataagggcggcccgcgtaag
ggtaacctgaccattattgaagcggcagacggttcattcagagcctttaccgactacaac
ggcaaatcacgtcaggaagtgcatattcttgaatacgtaccgggtgtgaaattccgtggt
cacttcgataactttatgtcgtacaccgagttcaattatgagtttgcaggcggcaagctt
aaagagggcagctaccagttgattggtaacgtgcgctggcctgcaacgggtgagctagtg
gcaagtagcgacgtgaaaggcagcgtgattcctgctccaaacggtggctatccagcagta
ctagaaggtgatgagaaggatctgattttaggaggtgagattaccgtctggggcgagaat
ctggattcaaccaccatcgaacatcgactgtggcctcgtagctatgcgattgcagagcgt
ctttggtctagtcaggagttgaccgatgagcgcagcatgtatcagcgcatgaaagtgatg
gatacttggtctgaaatctcgctgggccttcgtcatcacgcggatgccaacatgatgctc
aagcgtctggcgaatggtgctgatgttgcaccgttgcaaacgttgtcgaactacatcgaa
cccgcgcagtactacgcacgtcattgggagaagtggatctccacaccaaacaaaggtgac
ttgtacaacaagtacgagcgtctaaatcgttttgcggatgcgctaccgatggaaagcctc
acggtgtatgagatgaacgatttggttgaagcgttcgccaaaggggacactcttgcactg
gataagttggagcttcattaccagactgccaagcttgcggcgcagcaggcaaaaccgatt
tttgctgccaatgtggcatcagtggataccgtggtggtgtcagacgcgacagtgcgagtt
tctgagttagctctgactttgatagaagcagcaaagcaaggacaaacactgcgtgcgagt
gatgtggctgaatatcaacgcatcatcgatgataacgccattattcttgatgaaaccatt
gtggcgattgtcaaaccgaccgagatgttacttcacaaactggccaactaa

DBGET integrated database retrieval system