KEGG   Vibrio coralliilyticus OCN014: JV59_26515Help
Entry
JV59_26515        CDS       T03497                                 

Definition
(GenBank) magnesium transporter ApaG
  KO
K06195  ApaG protein
Organism
vct  Vibrio coralliilyticus OCN014
Brite
KEGG Orthology (KO) [BR:vct00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    JV59_26515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AIU65980
UniProt: A0A097QHR1
Position
1:complement(228536..228913)
Genome map
AA seq 125 aa AA seqDB search
MEANPCIKVQVHTKYISEQSQPDSKRYVFAYVITIKNLSNQTVQLISRRWLITDANGKQM
TVEGDGVVGQQPFIPGSDEYTYSSGTALETPVGVMQGQYILLDEKGREFSTEIEPFRLAL
PNILN
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggaagctaacccttgtattaaagttcaagttcataccaagtacatctctgagcagtct
cagcctgattcaaaacgctacgtctttgcctacgtcatcacaataaagaacctcagcaat
caaaccgtccaactcattagtcgtcgctggctgattactgacgccaatggcaagcagatg
acggtggaaggtgatggtgtggttggtcaacagcccttcattccaggaagtgatgaatat
acttacagcagcggtaccgctctagaaacgccagtcggtgtaatgcaaggccaatacatt
ctccttgacgaaaaaggccgagagtttagcaccgaaatagaacctttcagactcgctcta
ccgaatattctcaactaa

DBGET integrated database retrieval system