KEGG   Vibrio coralliilyticus OCN014: JV59_37210Help
Entry
JV59_37210        CDS       T03497                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
vct  Vibrio coralliilyticus OCN014
Pathway
vct00620  Pyruvate metabolism
vct01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    JV59_37210
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vct02000]
    JV59_37210
Enzymes [BR:vct01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     JV59_37210
Transporters [BR:vct02000]
 Other transporters
  Primary active transporters [TC:3]
   JV59_37210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: AIU67883
Position
1:complement(2826617..2828401)
Genome map
AA seq 594 aa AA seqDB search
MSKPLALTDVVLRDAHQSLFATRMRLEDMLPIAAELDKVGYWSLETWGGATFDACIRFLG
EDPWERLRALKKAMPNTPMQMLLRGQNLLGYRHYADDVVEKFVERAHANGMDVFRIFDAM
NDVRNFQKAVKAAVDVGAHAQGTLSYTTSPVHNTYTWVDLAKRLEDLGCHSLCIKDMSGL
LKPYEAEELISRIKSSTDIPLALHCHATTGLSTATAVKAVEAGVDILDTAISSMSCTYGH
TPTETVVAMLQGTERDTNLKLDQIEPIAAYFREVRKKYAKFEGQLKGVDSRILIAQVPGG
MLTNMESQLKEQGAADRIDEVLDEIPRVREDLGFIPLVTPTSQIVGTQAVINVLTGERYK
SITKETAGVLKGEYGAAPAEVNAELQAKVLDGAEAITCRPADLLEAELDTLTEDLLAKAK
QDGISLAEDTVDDVLTYALFPQVGLKFLKNRHNPDAFEPAPSKEEPVAAPAPQAAQGGIE
TYSVKVDGQVYDVEVGPQGQLTSVAPANSTPQQASPAPAAQSGNSEMVPAPLAGNIFKVN
VQSGAQVEEGEVLLILEAMKMETEVRAARGGIVQDLHVKEGDSVTVGAPLLSLA
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaccactagctttaaccgacgtggtgcttcgtgacgcccatcagtcgctgttt
gctactcgtatgcgtcttgaagatatgttacctatcgcagcggagctcgataaagtgggg
tactggtctttagaaacctggggcggtgccacctttgatgcgtgtatccgttttctagga
gaagacccttgggaacgtctacgcgcgcttaaaaaagcgatgcccaatacacccatgcaa
atgctacttcgtggccaaaacctgctaggttaccgccactacgcagatgatgtggttgaa
aaatttgtcgaacgtgcgcacgccaatggcatggatgtgttccgcatctttgatgcaatg
aacgatgtgcgcaatttccagaaagcggtcaaggcagcagtcgatgttggtgctcacgca
caaggtacgctttcttatactactagcccagttcacaatacctacacttgggttgatctg
gcgaagcgccttgaagatcttggttgccactctttatgcattaaagatatgtcaggcttg
cttaagccgtatgaagcggaagagctgatctctcgtatcaaatcatcgaccgatattcct
ttagcacttcactgtcacgcaacgactggcctttctactgcaacagcagtcaaagcagtc
gaagctggggtcgatattcttgatactgcgatctcctcaatgagctgtacatacggccac
actccgacggaaactgtggttgcgatgctccaaggcacagagcgtgataccaaccttaag
ttggaccagattgaaccaatagccgcttacttccgcgaagttcgtaaaaaatatgcgaaa
tttgaaggtcagctgaaaggggtagattcgcgcattcttatcgcccaggtgccaggcggc
atgctgactaatatggaaagccagcttaaagaacaaggtgcggcagatcgtattgatgag
gtattggacgagatcccgcgcgtgcgcgaagatttgggcttcattcctctggttacacct
acttcgcagattgtcggcacgcaagccgtgattaacgtgctaacgggtgagcgttacaag
agcatcaccaaagagacggcgggtgtcctaaaaggcgaatacggcgcagctccggcagaa
gtaaatgcggaactacaagcaaaagtactggatggtgctgaagccattacttgtcgccca
gcggatctgctggaagctgagttggataccctcactgaagatttgcttgctaaagcgaaa
caagatggtatttcattggctgaagatacggtcgatgatgtcttaacctacgcactattc
cctcaggttggtctgaagttccttaagaatcgccataatcctgatgctttcgagcctgct
ccaagtaaagaagagccagtggcagcacctgctcctcaagctgctcagggtgggattgag
acttacagtgtgaaagtcgatgggcaggtttacgacgtagaagtgggcccgcaaggtcaa
ttgacatcggttgctccggctaactcaacgcctcaacaggcttcgccagctcctgctgct
cagtcaggtaattcagagatggtacctgcgccattggcagggaacattttcaaagtgaat
gttcaaagtggagctcaagtggaagaaggtgaagtacttctgatcctcgaagcgatgaag
atggaaactgaagttcgcgcagcccgtggcggtatcgttcaagaccttcacgttaaggaa
ggtgactcagtgacggtcggcgcaccgctattgagtctggcgtaa

DBGET integrated database retrieval system