KEGG   Vibrio coralliilyticus OCN014: JV59_37885Help
Entry
JV59_37885        CDS       T03497                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
vct  Vibrio coralliilyticus OCN014
Pathway
vct03010  Ribosome
Brite
KEGG Orthology (KO) [BR:vct00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    JV59_37885
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:vct03011]
    JV59_37885
Ribosome [BR:vct03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    JV59_37885
  Bacteria
    JV59_37885
  Archaea
    JV59_37885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AIU67997
UniProt: A0A097QNG9
Position
1:complement(2949522..2949854)
Genome map
AA seq 110 aa AA seqDB search
MEALAKHNFARISPQKARLVADQIRGKSVDQALEILTFSNKKAADLVKKVLESAIANAEH
NEGADIDDLSVAKIFVDEGPIMKRIMPRAKGRADRILKRSSHITVVVADR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagcactagctaaacataactttgctcgcatttcgcctcagaaagctcgcttagtt
gcggatcaaatccgtggtaaatcagttgaccaagctctagaaatcctaactttcagcaac
aaaaaagctgctgacctagttaagaaagttcttgagtcagctatcgcgaacgcggagcac
aacgaaggtgcagatattgacgatctaagtgtcgcaaagatcttcgtagatgaaggccct
atcatgaagcgtattatgcctcgtgctaaaggtcgtgcggatcgtatcttgaagcgttca
agccacatcactgttgttgtagcagatcgctaa

DBGET integrated database retrieval system