KEGG   Vibrio cholerae O49 1154-74: VAA049_1408Help
Entry
VAA049_1408       CDS       T03828                                 

Definition
(GenBank) cheW-like domain protein
  KO
K03407  two-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]
Organism
vcx  Vibrio cholerae O49 1154-74
Pathway
vcx02020  Two-component system
vcx02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:vcx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VAA049_1408
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    VAA049_1408
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vcx01001]
    VAA049_1408
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:vcx02022]
    VAA049_1408
   02035 Bacterial motility proteins [BR:vcx02035]
    VAA049_1408
Enzymes [BR:vcx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     VAA049_1408
Protein kinases [BR:vcx01001]
 Histidine kinases
  CheA family [OT]
   VAA049_1408
Two-component system [BR:vcx02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   VAA049_1408
Bacterial motility proteins [BR:vcx02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    VAA049_1408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheW HATPase_c H-kinase_dim Hpt HATPase_c_3 HATPase_c_5
Motif
Other DBs
NCBI-ProteinID: AKB03421
Position
1549202..1551475
Genome map
AA seq 757 aa AA seqDB search
MQNFIIESRDLIESAARGLLALEANPDDKAIINELFREIHTVKGASGILDNIAPFTQLAH
RMEDLMQKVRDGHVALNGTMLDLMLGCCDQFLLWIEELEQHQELSAEAVSISKQMIAQLA
SLTQASPTHTPTSAVAAQEETATLSISELTELLGRDCFNDVEALLEYPDALLLIYTPDKQ
CFFSGDDPLAWMRSVEKVSWRKVVLIPDSEPFDTYQAQMQFLLLTQSAKKDLEQQLAPID
GQYRLYRIQSDNLPTAPIDQRTQYVERIVKQQIALLREEQVSESVRAGTFLSIKNLYCAL
SQQISDRPAPLPESVSADELITLFDNILLSFARRTAIIDKCENEPAQPSAITVNEQLDKV
KKKQIKTLKVDQEKVDLLMDLVGELIVAKNSMQYLAYRAENEFGVRKLAQDIKAEQSVIS
RLAEDLQSVVMQVRMVPLATVFQRYPRLIRDISRKLGKQVDLIIEGEDTEADKSIVEDLS
EPLVHLIRNALDHGIESPDIRREQGKNPTGKITLSAFTLDDSVIIKMSDDGKGVDVERVK
TKALERGLVEASKLERMSQQEIIHLIFEPGFSTVEQVSDLSGRGVGMDAVRTAIERNGGT
LTLSSEPGKGSEITMILPLSMTISRVMMFELEQQSFAIPIESVIQTLKISRHKDIRRVKN
LDTFILRGETVPILYLKRAFEMNSAQIYPDIQPILVVRVGDDVLGLAVDRLQEGQDVIIK
PLEGALATFSIYRGAAIMGDGRVLLVLDTEEVVKHAR
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacttcatcatcgagagccgagatttaattgaatccgcggcacgaggtctactt
gcgttagaagcgaatcccgatgacaaagccatcattaacgagttattccgagaaatacat
accgtaaagggagcctcaggtattctcgataatattgcgcctttcacccaattagcgcat
cgaatggaagatttgatgcagaaagtgcgtgatggacatgtggctttaaacggcacaatg
cttgacctgatgttgggctgctgcgatcaatttctcttatggattgaagagttagaacaa
caccaagagctctcagcagaggcggtatcgatcagtaaacagatgattgctcagttagca
tctttaactcaagcctcgccaacacacacgcctacctctgccgtagcggcgcaagaagag
acggccaccctctccatcagtgaattaacggagctattaggacgagattgtttcaacgat
gtagaagcgcttttggaatatcccgatgctttactcttgatttatacccccgataaacag
tgctttttctctggggacgacccattggcttggatgcgtagtgttgaaaaggtctcttgg
cgtaaagtggtgctcatcccagattctgagcctttcgatacctatcaggctcaaatgcag
tttctgctgctgactcaatcagcgaaaaaagacctagagcagcaacttgctccgatagac
ggtcaataccgcctttaccgcattcaatcggacaatctacccacagcacccattgatcag
cgcacgcaatatgtcgagcgaattgttaaacaacaaatcgctttgcttagagaagaacaa
gtttcggaatccgtacgtgctggtaccttcttatcgattaaaaatctctactgtgccttg
agccaacaaatcagtgatcgcccagctcccttgccagaatctgtctcggccgatgaactt
atcaccttgtttgataacattttactctcttttgctcgtcgaaccgccatcatcgataaa
tgcgaaaatgaacctgctcaaccctccgctatcacggttaacgagcagttagacaaagtg
aagaaaaaacagataaaaacactgaaggtggatcaggaaaaagtcgatttattgatggat
ttggtcggtgagctgattgttgcgaaaaactcgatgcaatatctcgcctatcgtgcagaa
aatgagtttggtgttcgtaaacttgcacaagatattaaagcagaacagagtgtgatatcg
cgtcttgctgaagacctacagtctgtcgtgatgcaggtccgcatggtaccactcgcgacc
gtttttcaacgctacccacgcttgatccgcgatatctcacgcaaactgggtaaacaagtc
gatctgatcatcgaaggtgaagacactgaggcagataaaagtattgttgaagatctctcc
gaacctttagtgcatctgatccgtaatgccctcgatcacggaatagaatcacccgacata
cgtcgcgaacaagggaagaatccaacaggaaaaattactctaagcgcttttactcttgat
gattctgtcatcatcaagatgagtgatgatggtaaaggcgttgatgtcgaacgtgtcaaa
accaaagctttggaacgcgggttagtggaagcgagcaaacttgagcggatgagccaacaa
gagattattcacttgatctttgaacccggcttttcaacggttgaacaagtcagtgatctc
tcaggacgcggtgtgggtatggatgcagttcgtacggctattgaacgcaacggcggcact
ctcacactctcctctgagccggggaaaggcagtgaaattaccatgatcctgccactttct
atgaccatttcacgcgtcatgatgtttgaacttgagcagcagtcctttgctattcccatt
gagtcggttatccaaacgttaaaaatatcccgacacaaagacattcgccgtgtaaaaaat
ctcgatacgttcattttacgcggtgaaactgtgcctattttgtatctcaagcgtgcgttt
gagatgaactctgcccaaatttatcccgacatccaacctattcttgttgtccgtgtgggt
gatgatgtattgggacttgccgtagatcgattacaagagggacaagatgtcatcatcaaa
cctcttgagggtgctttggccacattctccatctaccgtggtgccgccattatgggagat
gggcgtgtccttttagtgctcgatactgaggaggtagtaaaacatgcccgttga

DBGET integrated database retrieval system