KEGG   Vibrio cholerae O49 1154-74: VAA049_1766Help
Entry
VAA049_1766       CDS       T03828                                 

Definition
(GenBank) FAD dependent oxidoreductase family protein
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
vcx  Vibrio cholerae O49 1154-74
Pathway
vcx00310  Lysine degradation
vcx01100  Metabolic pathways
vcx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vcx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    VAA049_1766
Enzymes [BR:vcx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     VAA049_1766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Mqo Pyr_redox_2 NAD_binding_8 FAD_binding_3 FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AKB02643
Position
complement(1935208..1936419)
Genome map
AA seq 403 aa AA seqDB search
MTYDYVIVGGGIVGVSTAWQLKLRYPEKSVLLIEKEAGFSRHQTGHNSGVIHAGVYYAPG
SLKADFCKRGVERTLAFCAQHKIPVENCGKLLVATNEQELERMHALYDRCLQNQIDVEKL
DAVQLKLAEPNIRGLGAILVKATSIVNYRLVTEKMAEAFMQLGGDVKIGTEVVGLEETPS
SVTLTCQQKNQRVSYQAKFLVTCSGLMADRLTKMLGLPTDFQIIPYRGEYYRLAPKHNQV
VRHLIYPIPDPELPFLGVHLTRMIDGSVTVGPNAVQGFKREGYGKWNVSLRDVWEMVCFP
GFWKVSAKHFKTGMVEMKNSWWKAGYLQLVRKYCPSIELTDLYPYPAGIRAQAVLSDGTL
VHDFLFAESPRSLHVCNAPSPAATSAMPIGEYLCDKIAEKSLA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgacttatgattatgtgattgttggcggtgggattgtcggtgtctccaccgcttggcaa
ctgaaactgcgttatccggaaaaatcggtgctgttgattgagaaagaggcggggttttcc
cgccatcaaactggtcacaacagcggggtgatccatgcgggggtttattatgctcccggt
agtttgaaggctgatttttgtaaacgcggagtcgaacgcactttggcgttttgcgcgcag
cacaagattccagtggaaaactgtggcaagttactggtggccaccaatgagcaagaactc
gaacgcatgcacgcactctatgatcgctgcttacaaaatcagatcgacgttgaaaaactg
gatgccgtgcagttgaagctggcggaacccaatattcgtggcttgggggcgatcttggtg
aaagcgaccagtatcgtcaattatcgtctggtgaccgagaaaatggccgaagcctttatg
cagttggggggtgatgtgaaaataggcacggaagtggtgggcttggaagaaacgccatcc
tcggtcacgctaacttgccaacagaagaaccaacgcgtgagttatcaggccaaatttctg
gtcacctgttcaggcttaatggccgatcgcttaaccaagatgctcggtttgccgacggat
tttcagatcatcccttatcgtggcgaatactatcgtttggcacccaagcataaccaagtg
gtgcgtcatcttatctacccgattccggatcctgaattgccgtttctcggcgtacattta
actcgcatgattgatggcagcgtgaccgttggccccaatgccgtacaaggttttaagcgt
gaaggttatggcaaatggaatgttagcctccgcgatgtgtgggagatggtttgcttcccc
ggcttttggaaagtgagtgccaagcactttaaaacgggtatggtcgaaatgaaaaactca
tggtggaaagcgggctacttacagttggtacgtaaatactgcccaagtatcgaactaacc
gatctttatccttaccctgcaggcattcgtgcccaagcggtattaagtgatggtacgctg
gtgcacgattttctgtttgccgaaagtccgcgcagtttgcatgtgtgtaacgcgccttct
ccagcggccacttccgcaatgccaatcggcgaatatctgtgcgacaaaatcgcggaaaaa
tcgcttgcttga

DBGET integrated database retrieval system