KEGG   Vibrio cholerae O49 1154-74: VAA049_1791
Entry
VAA049_1791       CDS       T03828                                 
Name
(GenBank) AAA domain family protein
  KO
K11908  sigma-54 dependent transcriptional regulator
Organism
vcx  Vibrio cholerae O49 1154-74
Brite
KEGG Orthology (KO) [BR:vcx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vcx03000]
    VAA049_1791
Transcription factors [BR:vcx03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    VAA049_1791
SSDB
Motif
Pfam: Sigma54_activat Sigma54_activ_2 AAA_5 HTH_8 Mg_chelatase AAA_2 AAA DUF2381 AAA_16 TIP49
Other DBs
NCBI-ProteinID: AKB02251
UniProt: A0A023PRF8
Position
complement(1969766..1971358)
AA seq 530 aa
MSQWLAFATQLVGVRKSHQLALQFVDLLTQGLDLSDSLLLLPSSDGRLLVPHDPQRQFAW
SVTDFDVPFAHVLQSSNAMHLTAEELVFWQSNRTFSQLTSRVGMFDSVWIQPLPMDTRQV
HSILLLMGESHGIVSAFENADFLKFIEVFSQQWSLLNDMEREEQRRLELKQSLTDIERDS
AQRSLANALSRTLIGESAAMQKLREQIVSAANSQLSVMVQGETGTGKELVAAAVHELSSR
KSAPFVAINCAAIPEHLLESELFGYCKGAFSGADSDKQGLIAQANGGTLFLDEIGDMPLT
LQAKLLRVLESRTFRPLGGKQELSSDFRLVSATHVNLLDQVRKKEFRQDLYYRLFQYPIT
LPRLAARLEDIELLSEHFVRVFNLQHNTRIRGLNYRAIDCLKQYDFPGNVRELKHLIEFG
CAQTADGTQVEASCFAHRLQTLPCLAPEATPVAVSVETENVDLEPSVALAGEPNFAVIHD
LKQAVSQFEALIISERLNRFAGDRAKAAKSLGIPKRTLAYKCLKLEIKTP
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgagtcaatggctggcgtttgcaacccaattggtgggagtaaggaagtcccaccagctt
gcgctgcaatttgttgatctgctgactcaaggcttagatctgagtgatagccttttgttg
ttgccatcgtcggatgggcgtttacttgtgcctcatgatccacagcgtcagttcgcgtgg
tcagtgacggattttgatgtgccttttgcccatgttttgcagtcatccaatgcgatgcat
ttgaccgcggaagagttggtattttggcaatccaatcgcacttttagccagttaacctct
cgcgtggggatgtttgattcggtatggatccaacccctgccgatggatactcgccaagta
cactcgatattgctgttgatgggcgagagtcacggtatcgtgagcgcttttgaaaacgcg
gactttttgaagtttatcgaggtcttttcccagcaatggtcactgctcaacgatatggaa
cgtgaagagcagcgccgcttggagctgaaacaatcgctgacggatattgaacgcgactcg
gcgcagcgctcactggccaatgcgttatcgcgtactttgattggtgaaagcgctgcgatg
caaaagctgcgtgagcagattgtctctgccgccaactctcagctctcggtcatggtgcaa
ggtgaaactggcacgggtaaagagttagtcgccgcggccgtgcatgaactttcgtcacgt
aagtctgcgccgtttgttgcgatcaactgtgcggcgatccctgagcatctattggaaagt
gaactgtttggttactgcaaaggggcattttctggagcggacagcgataaacagggactt
atcgcacaagcgaatggtggcacgctatttttggatgagatcggcgatatgccgctcacc
ttacaagccaaattattgcgtgtgcttgaatcgcgtactttccgaccgctcggtggtaag
caggagctcagttccgatttccgtctggtatcggccacacacgtcaatctgctggatcaa
gtacgcaaaaaagaatttcgccaagatctctattaccgtctattccagtatccgatcacc
ttgccgcgtctggcggcacgcttggaagatattgagctgctcagtgagcactttgtgcgc
gtgttcaacttgcaacataacacgcgcattcgtggtttgaactatcgagccatcgactgc
cttaagcagtacgacttcccgggaaatgtgcgtgagctgaaacatttgattgagtttggc
tgcgcgcaaacagcagatggtacgcaggtggaagccagttgctttgcccatcgtttacaa
accctaccctgtcttgcgcctgaagcgacgccggtagccgtttctgtcgaaactgagaac
gtggatcttgaaccctcggttgcgctggctggagaaccgaattttgcggttatccatgat
ttgaaacaggcggtcagtcagtttgaagcgttgatcatcagtgagcgtttgaaccgcttt
gctggcgatcgcgcgaaagcggcgaaaagtctcggtatccctaagcgtaccttggcctac
aagtgcctgaaattggagatcaaaaccccatga

DBGET integrated database retrieval system