KEGG   Vibrio cholerae O49 1154-74: VAA049_1795
Entry
VAA049_1795       CDS       T03828                                 
Name
(GenBank) type VI secretion lipofamily protein
  KO
K11906  type VI secretion system protein VasD
Organism
vcx  Vibrio cholerae O49 1154-74
Pathway
vcx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vcx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VAA049_1795
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcx02044]
    VAA049_1795
Secretion system [BR:vcx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VAA049_1795
SSDB
Motif
Pfam: T6SS-SciN LPAM_1
Other DBs
NCBI-ProteinID: AKB02799
UniProt: A0A2A1YU60
Position
complement(1976113..1976589)
AA seq 158 aa
MNKVLWMLFALTVLTACSSSDKYEPAKEPTKVTFSLVSDEGVNPNIWGEASPIEIQVFEL
KDDSMFMSSDYDQIKTDYKKALRSNFVKNYDYVLTPGQFKFVNAFEVDEETNYIGVMAHF
AEPELSEWKKAVKVINKGREYHLLMLFKDYDVKLDRVE
NT seq 477 nt   +upstreamnt  +downstreamnt
gtgaacaaagtgctgtggatgctgtttgccttgacggtgctgaccgcgtgcagttcgtcg
gataagtacgagcctgcgaaagagccgaccaaggtgacttttagcttagtcagcgatgaa
ggggtgaacccgaacatctggggtgaagcgtcaccgatagaaattcaagtgtttgagcta
aaggatgactcgatgtttatgtcgtccgactacgaccagatcaaaaccgattataaaaaa
gcgctgcgcagtaactttgttaaaaactacgactatgtactgactccagggcagttcaaa
ttcgtcaacgctttcgaagtcgatgaggagaccaactacatcggcgtgatggctcatttt
gccgagcctgaactcagcgaatggaagaaagcggtcaaggtgatcaataaagggcgagag
tatcacttgctgatgctgtttaaagactacgatgtgaaattggatagggtggaataa

DBGET integrated database retrieval system