KEGG   Vibrio cholerae O49 1154-74: VAA049_1801
Entry
VAA049_1801       CDS       T03828                                 
Name
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
vcx  Vibrio cholerae O49 1154-74
Brite
KEGG Orthology (KO) [BR:vcx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcx02044]
    VAA049_1801
Secretion system [BR:vcx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VAA049_1801
SSDB
Motif
Pfam: T6SS_VipA BACON
Other DBs
NCBI-ProteinID: AKB02498
UniProt: A0A085TAW9
Position
complement(1982796..1983302)
AA seq 168 aa
MSKEGSVAPKERINIKYIPATGDAQAEVELPLKTLVVGDFKGHAEQTPLEERATVTVDKN
NFEAVMRESELKITATVKNKLTDDENAELPVELNFKSLADFAPDAVASQVPELKKLIELR
EALVALKGPLGNIPAFRERLQSLLNSEESREKLLAELNLLSGQEEPQA
NT seq 507 nt   +upstreamnt  +downstreamnt
atgtctaaagaaggaagtgtagctcccaaagagcggattaatatcaagtatattccggcg
acgggggatgcacaggctgaggttgagctaccactcaaaaccctggttgtaggtgatttc
aaagggcatgcggagcaaaccccattggaagagcgtgcaacagtcacggtagataagaac
aactttgaagccgtaatgcgcgagagcgagctgaaaatcaccgctacggtgaaaaacaag
ctgactgatgatgagaatgccgagcttcctgttgaactcaatttcaaatccttagccgac
ttcgctcctgatgcggtggcatcacaagttccagaactgaaaaaattgattgagttgcgt
gaagcgttagttgccctcaaagggccgctaggcaacattcccgcatttcgtgagcgttta
cagtcattactcaactcagaagagtcgagagaaaaactgttggcagaactgaatctgctc
agtggtcaagaagagccacaagcgtaa

DBGET integrated database retrieval system