KEGG   Vibrio cholerae O49 1154-74: VAA049_2090Help
Entry
VAA049_2090       CDS       T03828                                 

Gene name
gnd
Definition
(GenBank) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
vcx  Vibrio cholerae O49 1154-74
Pathway
vcx00030  Pentose phosphate pathway
vcx00480  Glutathione metabolism
vcx01100  Metabolic pathways
vcx01110  Biosynthesis of secondary metabolites
vcx01120  Microbial metabolism in diverse environments
vcx01130  Biosynthesis of antibiotics
vcx01200  Carbon metabolism
Module
vcx_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
vcx_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:vcx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VAA049_2090 (gnd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    VAA049_2090 (gnd)
Enzymes [BR:vcx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     VAA049_2090 (gnd)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     VAA049_2090 (gnd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 F420_oxidored 2-Hacid_dh_C Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AKB04652
UniProt: A0A085QR50
Position
complement(2320327..2321775)
Genome map
AA seq 482 aa AA seqDB search
MKGDIGVIGLAVMGQNLILNMNDHGFKVVAHNRTAAKVDEFLEGPAKGTNIVGAYTLQEL
VDKLATPRKVMLMVRAGQVVDDFIEQLVPLLDKGDIIIDGGNTNFPDTNRRVKALREKGI
HFIGTGVSGGEEGARFGPSIMPGGAPEAWEAVKPIFQGISAKTDAGEPCCDWVGNDGAGH
FVKMVHNGIEYGDMQLITEAYQFMKDGLGMSADEMQAVFADWNKTELDSYLVEITADILG
YKDEDGEALVEKILDTAGQKGTGKWTGINALDMGIPLTLITESVFSRCLSALKDQRVEAE
KLFGKTKTQVEGDKQVWVDALRQALLASKIISYAQGFMLMREASNENGWNLNYGNVALMW
RGGCIIRSAFLGNIRDAFEKNPELAFLGSDAYFKGILDNCLAAWRKVAAKSLEVGIPMPC
TTSALTFLDGYTTARLPANLLQAQRDYFGAHTYERIDRPRGEFFHTNWTGTGGNTASTTY
DV
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtgatatcggtgtaatcggccttgcagtcatgggccaaaacctgatcctcaac
atgaacgaccacggcttcaaagtggtggcacacaaccgtaccgcggctaaagtggacgag
tttctagaaggcccagccaaaggcactaacattgttggcgcttacactctgcaagagctg
gttgataaactggcgacaccacgcaaagtgatgctgatggtgcgtgcgggtcaagtggtt
gatgacttcatcgagcagctggttccactgctcgacaaaggcgacatcatcattgatggt
ggtaacaccaacttccctgatactaaccgccgtgtcaaagcactgcgtgaaaaaggtatt
cacttcatcggtacgggtgtttctggtggtgaagaaggcgcacgtttcggaccttcgatc
atgccgggtggcgcacctgaagcatgggaagcggtaaaaccgattttccaaggcatttct
gccaaaactgacgctggcgagccttgctgtgactgggtgggcaacgatggtgccggtcac
ttcgtgaaaatggttcacaacggtatcgaatacggcgacatgcagcttatcactgaagct
taccagttcatgaaagatggtctgggaatgtcggccgatgaaatgcaagccgtatttgct
gactggaacaaaactgagctagacagctacttggttgagatcaccgctgatatccttggc
tacaaagatgaagatggtgaagcgctggttgagaagatcctcgatactgctggccaaaaa
ggcacaggtaaatggacgggcatcaacgcgctggacatgggcatcccactgacgctgatc
acggaatccgtgttctctcgctgcctatccgcactgaaagatcaacgtgttgaagctgaa
aaactgtttggtaaaaccaaaactcaagtcgaaggtgacaaacaagtttgggttgatgcg
ctgcgtcaagcgctgctggcttcaaaaatcatctcttacgcacaaggctttatgctgatg
cgtgaagcatcgaacgagaatggttggaacctgaactacggtaacgtggctctgatgtgg
cgtggtggttgtatcatccgctctgcgttcctaggcaacatccgtgatgcgtttgaaaag
aacccagaactggcgttcttaggttctgatgcgtacttcaaaggtattctggacaactgt
ctggctgcatggcgtaaagtggcagcgaagtcgctggaagtcggcattccaatgccatgt
actacttcagcactgaccttcctagatggttacactacggctcgcctgccagcgaacctg
ctgcaagcacagcgtgattactttggtgcgcacacttatgagcgtatcgatcgtccgcgt
ggtgagttcttccacactaactggacgggtacaggcggtaatactgcgtctaccacttac
gacgtgtaa

DBGET integrated database retrieval system