KEGG   Vibrio cholerae O49 1154-74: VAA049_2224Help
Entry
VAA049_2224       CDS       T03828                                 

Gene name
cobQ
Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
vcx  Vibrio cholerae O49 1154-74
Pathway
vcx00860  Porphyrin and chlorophyll metabolism
vcx01100  Metabolic pathways
Module
vcx_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:vcx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VAA049_2224 (cobQ)
Enzymes [BR:vcx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     VAA049_2224 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26
Motif
Other DBs
NCBI-ProteinID: AKB05032
UniProt: A0A5C9IJS2
Position
2484315..2485769
Genome map
AA seq 484 aa AA seqDB search
MKKWLMVQGTTSDAGKSVLVAGLCRVLARRGIQVCPFKPQNMALNSAVTPDGGEIGRAQA
VQAQACGIAPSVHMNPVLLKPNSDTGAQVILQGRALSNMEANAYHDYKKVAMDTVMDSFQ
RLQQEYEAIMIEGAGSPAEINLRENDIANMGFAEKADVPVIIVADIDRGGVFAHLYGTLA
LLSESEQARVKGFVINRFRGDIGLLQSGLDWLEQKTGKPVIGVLPYLHGFDLEAEDAIAA
QQNLSADRQLRVAVPVFTRISNHTDFDPLRLNPNIDFRYVGQGESLSGADLIILPGSKST
RADLAYLRSQGWDKEILRHLRLGGKVMGICGGFQMLGEWVHDPLGLEGEAGSSEGLGLFA
MQTELTAEKRLTNVQGHLTLDGQTVAAQGYEIHAGRSSWATDQKSPIILSDGSLDGLVSD
CNQGFGTYLHGIFDRPETALRICQWAGAKEIEAYDHRAAQERAIDRIADAIEQHLNLTLL
WPDL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatggttaatggtgcaaggcaccacctcagatgcgggaaaaagcgtgttggtt
gccggcttgtgccgagtattggcgcgtcgcggcattcaagtttgccctttcaagccccag
aacatggcgcttaacagcgcggtaacgcctgacgggggtgagataggccgcgcgcaagcg
gtacaagcgcaagcctgtggtattgcgccgagcgtacacatgaatccggtgctgttgaaa
cccaattcagatacgggcgcgcaagtgattttgcaaggccgcgccttatccaacatggaa
gcgaatgcttatcacgactacaaaaaggtcgcgatggatacagtgatggattccttccag
cgcctgcaacaagagtatgaagccatcatgattgagggggcgggcagccctgcggaaatc
aacttacgtgagaatgacatcgccaatatgggctttgctgaaaaagccgatgtgcctgtg
atcatcgtagcggatattgatcgcggcggcgtgtttgcccatttatacggcaccttggcg
ctgctttctgagtctgagcaagcgcgggtaaaaggctttgtgattaaccgctttcgcggc
gacattggcttgctgcaatcagggctcgattggttggagcagaaaaccggtaaacctgtg
attggtgtgttgccttatctgcatggctttgatctggaagcagaagatgcgattgccgcg
cagcaaaacctgtcggcggatcgccaattgcgtgtggcggttccggtgtttacgcgcatc
agcaatcacactgattttgatccgctgcggctcaatcccaatatcgattttcgttatgtt
gggcagggcgagtcactgtcgggcgcagatttaatcatcctccccggaagcaaatccacc
cgtgctgatctggcttatttacgttcacaaggttgggataaagagatcctccgtcacttg
cgcttaggcggcaaagtgatgggcatttgtggcggttttcaaatgcttggagaatgggta
catgatccgcttggccttgaaggtgaggctggcagcagcgaaggtctggggctgtttgcg
atgcaaaccgagcttaccgccgaaaagcgcctcactaacgtgcaaggtcatttgacctta
gatggccaaaccgtggccgcgcaaggttatgagattcatgcggggcgctcaagttgggca
actgatcaaaaaagcccgattatactcagtgatggcagcttggatgggttagtcagtgac
tgtaatcaaggctttggcacctatttacatggtatttttgaccgccctgaaacggcattg
cgcatttgccaatgggctggcgcaaaagagattgaagcgtatgatcaccgagcggcgcaa
gagcgggcgattgaccgtattgcggatgcgattgagcagcacctcaacctcacgcttttg
tggcctgacttataa

DBGET integrated database retrieval system