KEGG   Vibrio cholerae O49 1154-74: VAA049_2258Help
Entry
VAA049_2258       CDS       T03828                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vcx  Vibrio cholerae O49 1154-74
Pathway
vcx00071  Fatty acid degradation
vcx00280  Valine, leucine and isoleucine degradation
vcx00310  Lysine degradation
vcx00362  Benzoate degradation
vcx00380  Tryptophan metabolism
vcx00620  Pyruvate metabolism
vcx00630  Glyoxylate and dicarboxylate metabolism
vcx00640  Propanoate metabolism
vcx00650  Butanoate metabolism
vcx00900  Terpenoid backbone biosynthesis
vcx01100  Metabolic pathways
vcx01110  Biosynthesis of secondary metabolites
vcx01120  Microbial metabolism in diverse environments
vcx01130  Biosynthesis of antibiotics
vcx01200  Carbon metabolism
vcx01212  Fatty acid metabolism
vcx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vcx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VAA049_2258
   00630 Glyoxylate and dicarboxylate metabolism
    VAA049_2258
   00640 Propanoate metabolism
    VAA049_2258
   00650 Butanoate metabolism
    VAA049_2258
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VAA049_2258
   00072 Synthesis and degradation of ketone bodies
    VAA049_2258
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VAA049_2258
   00310 Lysine degradation
    VAA049_2258
   00380 Tryptophan metabolism
    VAA049_2258
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VAA049_2258
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VAA049_2258
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VAA049_2258
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vcx04147]
    VAA049_2258
Enzymes [BR:vcx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VAA049_2258
Exosome [BR:vcx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VAA049_2258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKB03477
Position
2526972..2528177
Genome map
AA seq 401 aa AA seqDB search
MEKIYIVGAKRSAIGAFGGSLKECSAGALAGQVIQAALEAAQLKTEAVDEVIVGNVVSAG
QGMGVGRQAALAAGVPQSVPAYSINMVCGSGMKSVMDAVAHIKAGDASVVVAAGVEVMSQ
IPFVTPASLRDGQKMGAFEVKDLLIHDGLTDVFNQYHMGVTAENIAKQYDIARQTQDEFA
LASQMKATAAIEAGHFKREIVPIPVKKRRETVVFDTDEYPKPTTTLAALQGLRAAFDAQG
TVTAGNASGINDGASAVIIASESAVKKLGLTPIAEIMSYAQTGLDPKVMGLGPVSAVTQA
LAKAELSITQVDLFELNEAFAAQALGVVYGLAEQHAIQPEAILEKANVNGGAIALGHPLG
ASGNRILVTLLHELQRRQKHYGVASLCVGGGMGTAIVIKTV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagatctatatcgtgggcgcaaagcgctcagctatcggagcctttggtggttca
cttaaagagtgttcagcaggcgctttggcagggcaagtcatccaagccgctcttgaagcc
gcacaactcaaaactgaagctgtggatgaagtgattgttggtaacgttgtgagtgccgga
caaggcatgggtgttgggcgtcaagcggctttagcggctggtgttccacagtcggttcca
gcttacagcatcaacatggtgtgtggcagtgggatgaaatcggtgatggatgcggttgcg
cacatcaaagcgggagatgcttctgtcgttgtggccgctggtgttgaggtcatgtcacaa
atcccatttgttacgcctgccagcttacgagatgggcagaaaatgggtgcgtttgaagtg
aaagatctgctcatccatgacggtctgaccgatgtcttcaatcaatatcacatgggtgtg
acggcagaaaatatcgctaaacagtacgacatcgctcgtcaaacacaagatgagtttgcg
ttggccagccaaatgaaagcgacagcggccattgaagccggacattttaagcgagaaatt
gtgcctattccggtcaaaaaacgccgtgaaaccgtggtgtttgatacggatgaataccct
aaaccgacgaccacgttggccgcattgcaaggcttacgcgccgcgttcgatgcacaaggt
acggttaccgcaggtaatgcttctggaattaacgatggtgccagtgcggtgattatcgcc
agtgaaagtgcggtaaaaaaactaggcttaacgcctatcgcagaaattatgagttatgca
caaacagggttggatccgaaagtcatgggcttagggcctgtgagtgcagtcactcaagca
ttagcgaaagcagaattatctatcactcaggttgatctgtttgaacttaacgaagcgttt
gccgctcaagcattaggtgtcgtttacggtttagctgagcaacacgcgattcaacctgag
gcgattttagaaaaagccaacgtcaatggcggtgccattgcgttagggcatccattaggg
gcatcgggtaaccgcattctggttactctgcttcatgaattacagcgtcgccaaaaacat
tatggcgttgcttcactctgcgtcggcggtggcatgggtaccgcgatcgtgattaaaaca
gtttaa

DBGET integrated database retrieval system