KEGG   Vibrio coralliilyticus RE98: IX92_08975Help
Entry
IX92_08975        CDS       T03444                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vcy  Vibrio coralliilyticus RE98
Pathway
vcy00071  Fatty acid degradation
vcy00072  Synthesis and degradation of ketone bodies
vcy00280  Valine, leucine and isoleucine degradation
vcy00310  Lysine degradation
vcy00362  Benzoate degradation
vcy00380  Tryptophan metabolism
vcy00620  Pyruvate metabolism
vcy00630  Glyoxylate and dicarboxylate metabolism
vcy00640  Propanoate metabolism
vcy00650  Butanoate metabolism
vcy00900  Terpenoid backbone biosynthesis
vcy01100  Metabolic pathways
vcy01110  Biosynthesis of secondary metabolites
vcy01120  Microbial metabolism in diverse environments
vcy01130  Biosynthesis of antibiotics
vcy01200  Carbon metabolism
vcy01212  Fatty acid metabolism
vcy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vcy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    IX92_08975
   00630 Glyoxylate and dicarboxylate metabolism
    IX92_08975
   00640 Propanoate metabolism
    IX92_08975
   00650 Butanoate metabolism
    IX92_08975
  09103 Lipid metabolism
   00071 Fatty acid degradation
    IX92_08975
   00072 Synthesis and degradation of ketone bodies
    IX92_08975
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IX92_08975
   00310 Lysine degradation
    IX92_08975
   00380 Tryptophan metabolism
    IX92_08975
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    IX92_08975
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    IX92_08975
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    IX92_08975
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vcy04147]
    IX92_08975
Enzymes [BR:vcy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     IX92_08975
Exosome [BR:vcy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IX92_08975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SBP_bac_3 Chon_Sulph_att
Motif
Other DBs
NCBI-ProteinID: AIW19179
Position
1:1979294..1980508
Genome map
AA seq 404 aa AA seqDB search
MKRVFIVAAKRTPIGSFNGSLAPLSAVELGAHAIQSAIAQANLSVDLVDEVIMGNVLTAG
SGMGPGRQAAIKAGIPDSVPAYTINMICGSGLKAVMDAASHIRAGDAEVVIAGGMESMSN
AAFITNGQIRRGYRMGHQNLEDSIIKDGLTDAFHHYHMGITAENVAKHLGISREAQDEFA
LSSQNNAATAIEQGHFDAEIEPITVTQRRAQTEVSQDEYPKANATIEGLAKLRAAFDPDG
TVTAGNASGINDGASAVILVNQEALERYNLTPLAEIVEYGQGALKPEIMGLGPVTAINNT
LEKAQLSLSDIDVFELNEAFAAQALGVIKELSHQHNVEPQWLLDNSNLSGGAIALGHPIG
ASGNRILTTLVYQLERNNKRMGLASLCIGGGMGAAVILKRCEEQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgagtatttattgttgctgccaagagaacgccaatcggcagtttcaatggttcg
ttagcgccattgtcagcggttgagctcggtgcccacgccattcagagcgcaatcgctcaa
gcaaatctctctgtcgatttagtcgacgaagtcatcatgggcaatgtcctaactgcaggt
tcaggcatggggccaggaagacaggcagccatcaaagcaggcatcccagactctgtccct
gcttataccatcaacatgatttgtggtagcggcctgaaagctgtgatggacgcggcaagc
catattcgcgctggcgatgcagaagtggtcatcgcaggtggtatggagagcatgtctaac
gcagcctttattaccaatggccaaatccgacgtggctatcgaatgggccatcaaaatctg
gaagactccattattaaagatggcctgaccgatgcgtttcatcactaccacatgggcatc
acggcggaaaacgtagctaaacacctcggcatcagccgcgaagcacaagatgaatttgcc
ctgtctagccaaaacaatgcggcgacagcgattgaacaaggtcactttgatgctgaaatt
gagcccatcaccgtaactcaacgtcgcgcgcaaaccgaagtctcacaagacgaatatccg
aaagctaatgcgacaatcgaaggtctagccaaactaagagcggctttcgacccagacgga
acggtgaccgcaggcaacgcttcaggaatcaacgatggtgcttcggctgtcattcttgtt
aaccaagaagcgttggagcgctacaacctgacaccactcgcggaaattgtcgaatatggt
cagggcgcattgaagccagaaatcatgggccttgggccagtcaccgcgatcaataacact
ctcgaaaaagcgcagcttagcctaagtgacatcgatgtattcgaactcaatgaagccttc
gctgctcaagctttaggagtaataaaagagcttagccaccagcacaacgtcgagccacag
tggttactcgacaacagcaacctgagtggcggtgcaattgctttaggtcacccaatcggg
gcttctggtaaccgtattctcactactctggtttatcagcttgaaagaaacaataaacgc
atgggcttggcttcactgtgtatcggcggcggaatgggcgcggcagtgatcttaaagcgc
tgcgaggagcaatga

DBGET integrated database retrieval system