KEGG   Vibrio coralliilyticus RE98: IX92_13115Help
Entry
IX92_13115        CDS       T03444                                 

Definition
(GenBank) magnesium transporter ApaG
  KO
K06195  ApaG protein
Organism
vcy  Vibrio coralliilyticus RE98
Brite
KEGG Orthology (KO) [BR:vcy00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    IX92_13115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AIW19933
UniProt: A0A097QHR1
Position
1:2848328..2848705
Genome map
AA seq 125 aa AA seqDB search
MEANPCIKVQVHTKYISEQSQPDSKRYVFAYVITIKNLSNQTVQLISRRWLITDANGKQM
TVEGDGVVGQQPFIPGSDEYTYSSGTALETPVGVMQGQYILLDEKGREFSTEIEPFRLAL
PNILN
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggaagctaacccttgtattaaagttcaagttcataccaagtacatctcagagcagtct
cagcctgattcaaagcgctacgtctttgcctacgtcatcacgataaagaacctcagcaat
caaaccgtccaactcattagccgtcgctggctgattactgacgccaatggcaaacaaatg
acggttgaaggtgatggtgtggttggtcaacagccattcattccgggaagtgatgaatat
acttacagcagcggcaccgctctagaaacaccagtcggtgtaatgcaaggacaatatatt
ctccttgatgaaaaaggccgagagtttagcaccgaaatagaacccttcagactcgctcta
ccgaatattctcaactaa

DBGET integrated database retrieval system