KEGG   Vibrio cholerae O27 10432-62: VAB027_2016Help
Entry
VAB027_2016       CDS       T03829                                 

Gene name
acnD
Definition
(GenBank) 2-methylisocitrate dehydratase, Fe/S-dependent
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
vcz  Vibrio cholerae O27 10432-62
Pathway
vcz00640  Propanoate metabolism
vcz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    VAB027_2016 (acnD)
Enzymes [BR:vcz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     VAB027_2016 (acnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AKB06891
Position
2159634..2162240
Genome map
AA seq 868 aa AA seqDB search
MNSLYRKALSPNPTQSQVDFFDTRAAVEALKPGAYQTLPYTARILAENLVRRCPPEQLSE
SLLQIIERKRDLDFPWYPARVVCHDILGQTALVDLAGLRDAIADQGGDPAQVNPVVETQL
IVDHSLAVEYSGCDPDAFEKNRAVEDRRNEDRFHFIEWCKTAFKNVSVIPAGNGIMHQIN
LEKMSPVVQVKEGVAFPDSCVGTDSHTPHVDALGVLAIGVGGLEAETVMLGRPSMMRLPD
IVGVKLTGARQPGITATDIVLALTEFLRRERVVSAYLEFFGEGAKALTIGDRATISNMTP
EYGATAGMFYIDEQTIQYLKLTGREPEQVALVESYAKAAGLWADSLAHAEYERVLEFDLS
SVERNLAGPSNPHRRLPTKDLSARGIAIPAQQREAQQAEGLMPDGAVIIAAITSCTNTSN
PRNVVAAGLLAKKANQLGLKRQPWVKTSFAPGSKVAKLYLEEAGLLSELEQLGFGIVAYA
CTTCNGMSGALDPAIQQEIIERDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAI
AGTMRFDIERDALGHDAQGKPIYLNHLWPSDEEIDAVVGRAVKPEQFKQIYIQMFKLDET
QSASSPLYDWRPMSTYIRRPPYWEGALAAPRTLKAMRPLAILGDNITTDHLSPSNAILAS
SAAGEYLTKMGVPEEDFNSYATHRGDHLTAQRATFANPKLFNEMVKENGQIKQGSLARIE
PEGKVTRMWEAIETYMNRKQPLIVIAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIH
RTNLVGMGVLPLEFKPGVNRHSLALDGTELFDVVGEIRPGADLALVVTRKNGEKLDVAVT
CRLDTADEVHVYQAGGVLQRFAQDFLAQ
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtctgtatcgtaaagctttatcgccaaaccctacgcaatctcaggtcgatttt
tttgatacgcgcgctgcggtcgaggcgttaaaaccgggcgcataccaaactttgccttac
acggcgcgcattctggccgaaaatttggtgcgccgctgcccaccggaacaattgagcgaa
agtctgctgcaaattatcgagcgtaaacgcgatcttgatttcccttggtatcccgcgcgc
gtggtgtgccacgatattctcggccaaaccgcactggtcgatctagcgggcttgcgtgat
gcgatagccgatcaaggcggcgaccccgcgcaagtcaatcctgtcgtagagactcagttg
attgtcgatcattcgttggcggtggaatattctggctgcgatcctgatgcgtttgaaaaa
aatcgcgcagtagaagacagacgcaacgaagatcgcttccactttatcgagtggtgtaaa
accgcgtttaaaaacgtcagcgtgatccccgccggtaacggcataatgcatcagatcaat
ctggaaaaaatgtcgccagtggtgcaagtgaaagagggcgtggcattccctgattcttgc
gtaggaaccgatagccacacgccacacgtcgatgccctcggtgtgctcgcgattggtgtg
ggcggccttgaagcggaaactgtaatgctcggtcggccttccatgatgcgcttgccagat
attgtcggtgtgaaactgaccggagcgcgccaaccgggcattaccgcaaccgatattgtg
ttggccttaaccgaatttctgcgccgcgagcgcgtggtctcggcctatctggaatttttc
ggcgaaggggcgaaagcgctgaccattggcgatcgcgcgaccatctccaacatgacgccg
gaatacggcgcgaccgccggcatgttctacattgatgaacagaccattcaatacttaaaa
ctgactggccgcgagccagagcaagtcgctttggtcgaaagctacgccaaagccgcaggt
ttatgggctgatagtttagcgcacgcggaatacgaacgtgtgctggagtttgatctctcc
agcgttgagcgcaatttggcggggccttccaatccgcatcgccgtttgccgaccaaagat
ctgagcgcgcgcggcattgccatacctgctcagcaacgagaagcacaacaagcagagggc
ttgatgcctgatggcgcggtgatcatcgccgctatcacttcctgtaccaacaccagtaac
ccgcgtaacgtggttgcggcagggctactcgccaaaaaagctaatcagctcggccttaaa
cgtcaaccttgggtgaaaacctcatttgcgcccggctcgaaagtcgccaaattgtacttg
gaagaggctgggctgctctctgaacttgaacaacttggctttgggattgtggcgtatgcc
tgtaccacttgtaacggcatgagtggcgcgctcgacccagccattcaacaagaaattatt
gaacgcgatctctacgctacggcggtgctgtctggcaaccgcaactttgatggccgtatc
catccgtatgccaaacaagcgtttttggcttcgccgccactggtcgtggcttacgcgata
gcaggcacgatgcgctttgatattgagcgtgacgcgctgggtcacgatgcgcaaggcaag
ccaatttatctcaatcacttatggccaagtgatgaagagattgatgccgtcgtcggccgc
gcggtcaagccggagcagttcaagcagatctatatccagatgtttaaactcgatgagaca
caaagcgcgagctcaccgctgtatgactggcggccgatgagcacgtatattcgccgtcca
ccgtattgggaaggggcgctcgcggcgccgcgaaccttgaaagcgatgcgaccactggcg
attttgggtgacaacatcaccacggatcatttatcaccctccaatgccattttggcgagc
agcgcagctggagaatacctgaccaaaatgggcgtgccagaggaagattttaactcttac
gccacccaccgtggtgatcacctcaccgcacaacgtgccacgtttgccaacccgaaactg
tttaacgaaatggtcaaagaaaacgggcagatcaaacaaggttctctcgcgcgcattgag
ccggaaggcaaagtgacgcgcatgtgggaagcgattgaaacttacatgaaccgcaaacaa
ccgctgattgtgattgcgggagcggattacggccaaggctcatcacgtgattgggcggcc
aaaggtgtgcgtttagccggcgttgaggcgatcgtggccgaaggctttgagcgcattcac
cgcaccaacttggttgggatgggcgtactgccgctagagtttaagccgggcgtcaatcgc
cactcgctagcgctcgatggcactgagctgtttgatgtggtgggtgagatcaggcccggt
gcagatttagccctagttgtgaccagaaaaaacggcgagaagctggatgtggcggtgacg
tgtcgtttggacacggccgatgaagtgcacgtgtatcaagcgggtggcgtgttgcaacgc
ttcgcgcaagactttttggcgcagtag

DBGET integrated database retrieval system