KEGG   Vibrio cholerae O27 10432-62: VAB027_3502Help
Entry
VAB027_3502       CDS       T03829                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
vcz  Vibrio cholerae O27 10432-62
Pathway
vcz00564  Glycerophospholipid metabolism
vcz01100  Metabolic pathways
vcz01110  Biosynthesis of secondary metabolites
Module
vcz_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:vcz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    VAB027_3502 (psd)
Enzymes [BR:vcz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     VAB027_3502 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AKB07425
UniProt: A0A5R8KSU0
Position
3793765..3794622
Genome map
AA seq 285 aa AA seqDB search
MDKIKVGLQYWIPQHALTRLVGKLASARAGSLTTAIIRWFIKQYNVNMDEALHSDPTHFK
TFNEFFVRELKAGVRPIAEGEKVITHPADACVSQFGAIEDGKLIQAKGHTYSAQELLGGD
AKLAEEFRDGDFATLYLSPRDYHRVHMPCDGTLRQMIYVPGDLFSVNPLTAENVPNLFAR
NERVVCIFDTEFGPMAQVLVGATIVGSIELVWAGTVTPPRGNTVYRWDYPANGNQAVVLK
KGEEMGRFKLGSTVINLFAKQAIRFDDSMALGAPTRMGEPYAHQA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggataagattaaagttggactgcaatattggattccacaacatgccctgacccgcttg
gttggcaagttggcgtctgcgcgtgcaggcagcctgaccacggccatcatccgctggttc
atcaagcaatataacgtcaacatggacgaggctctgcactctgacccgacccacttcaag
acgtttaatgaattttttgtacgtgagctaaaagctggcgtgcgccctatcgctgaaggc
gaaaaggtgattactcatcctgccgatgcatgcgtgagtcagtttggtgcgattgaagac
ggtaagcttatccaagccaaaggccacacttactcagcccaagagctgctcggtggtgat
gccaagctcgcggaagaattccgcgatggagatttcgccactctgtatctctcgccacgg
gattaccaccgcgtacatatgccttgtgatggcacattgcgtcaaatgatctacgtaccg
ggcgatctgttctcggtcaatcctctgacagcggaaaatgtaccgaacttgtttgcccgc
aacgagcgtgtggtgtgtattttcgatacagaatttggcccaatggcacaagtgctggtt
ggtgccaccattgtcggcagtattgaactggtttgggcgggcaccgtgactccgccgcgt
ggcaacaccgtttatcgttgggactacccagccaacggtaaccaagccgtggttctcaaa
aaaggcgaagagatgggtcgctttaaactgggctccaccgtgatcaacctgtttgccaaa
caagctattcgctttgatgacagcatggcactaggcgcaccaacccgcatgggcgagccc
tacgcacaccaagcttaa

DBGET integrated database retrieval system