KEGG   Vibrio cholerae O27 10432-62: VAB027_484Help
Entry
VAB027_484        CDS       T03829                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vcz  Vibrio cholerae O27 10432-62
Pathway
vcz00071  Fatty acid degradation
vcz00280  Valine, leucine and isoleucine degradation
vcz00310  Lysine degradation
vcz00362  Benzoate degradation
vcz00380  Tryptophan metabolism
vcz00620  Pyruvate metabolism
vcz00630  Glyoxylate and dicarboxylate metabolism
vcz00640  Propanoate metabolism
vcz00650  Butanoate metabolism
vcz00900  Terpenoid backbone biosynthesis
vcz01100  Metabolic pathways
vcz01110  Biosynthesis of secondary metabolites
vcz01120  Microbial metabolism in diverse environments
vcz01130  Biosynthesis of antibiotics
vcz01200  Carbon metabolism
vcz01212  Fatty acid metabolism
vcz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vcz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VAB027_484
   00630 Glyoxylate and dicarboxylate metabolism
    VAB027_484
   00640 Propanoate metabolism
    VAB027_484
   00650 Butanoate metabolism
    VAB027_484
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VAB027_484
   00072 Synthesis and degradation of ketone bodies
    VAB027_484
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VAB027_484
   00310 Lysine degradation
    VAB027_484
   00380 Tryptophan metabolism
    VAB027_484
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VAB027_484
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VAB027_484
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VAB027_484
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vcz04147]
    VAB027_484
Enzymes [BR:vcz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VAB027_484
Exosome [BR:vcz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VAB027_484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKB05388
Position
548373..549578
Genome map
AA seq 401 aa AA seqDB search
MEKIYIVGAKRSAIGAFGGSLKECSAGALAGQVIQAALEAAQVKPEAVDEVIVGNVVSAG
QGMGVGRQAALAAGVPQSVPAYSINMVCGSGMKSVMDAVAHIKAGDASVVVAAGVEVMSQ
IPFVTPASLRDGQKMGAFEVKDLLIHDGLTDVFNQYHMGVTAENIAKQYDIARQTQDEFA
LASQMKAIAAIEAGHFKREIVPISVKKRRETVVFDTDEYPKPTTTLAALQGLRAAFDAQG
TVTAGNASGINDGASAVIIASESAVKKLGLTPIAEIMSYAQTGLDPKVMGLGPVSAVTQA
LAKAELSITQVDLFELNEAFAAQALGVVYGLAEQHAIQPEAILEKANVNGGAIALGHPLG
ASGNRILVTLLHELQRRQKHYGVASLCVGGGMGTAIVIKTV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagatctatatcgtgggcgcaaagcgctcagctatcggagcttttggaggttca
cttaaagagtgttcggcaggcgctttggcaggacaagtcatccaagccgctcttgaagcc
gcacaagtcaaacctgaagctgtggatgaagtgattgttggtaacgttgtgagtgccgga
caaggcatgggtgttgggcgtcaagcggctttagcggctggtgttccacagtcggttcca
gcttacagcatcaacatggtgtgtggcagtggcatgaaatcggtgatggatgcggttgcg
cacatcaaagcgggagatgcttctgtcgttgtggccgctggtgttgaggtaatgtcacaa
atcccatttgttacgcctgccagcttacgagatgggcagaaaatgggcgcgtttgaagtg
aaagatctgctcatccatgacggtctgaccgatgtcttcaatcaataccacatgggtgtg
acggcagaaaatatcgctaaacagtacgacatcgctcgtcaaacacaagatgagtttgcg
ttggccagccaaatgaaagcgatagcggccattgaagccggacattttaagcgagaaatt
gtgcctatttcggtcaaaaaacgccgtgaaaccgtcgtgtttgatacggatgaataccct
aaaccgacgaccacgttggcagcattgcaaggcttacgcgccgcgttcgatgcacaaggt
acggttaccgcaggtaatgcttctggaattaacgatggtgccagtgcggtgattatcgcc
agtgaaagtgcggtaaaaaaactaggcttaacccctatcgcagaaattatgagttatgca
caaacagggttggatccgaaagtcatgggcttagggcctgtgagtgcagttactcaagca
ttagcgaaagcagaattatctatcactcaggttgatctgtttgaacttaacgaagcgttt
gccgctcaagcattaggtgtcgtttacggtttagctgagcaacacgcgattcaacctgag
gcgattttagaaaaagccaacgtcaatggcggtgccattgcgttagggcatccattaggg
gcatcgggtaaccgcattctggttactctgcttcatgaattacagcgtcgccaaaaacat
tatggcgttgcttcactctgcgtcggcggtggcatgggtaccgcgatcgtgattaaaaca
gtttaa

DBGET integrated database retrieval system