KEGG   Vibrio cholerae O27 10432-62: VAB027_915
Entry
VAB027_915        CDS       T03829                                 
Name
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
vcz  Vibrio cholerae O27 10432-62
Brite
KEGG Orthology (KO) [BR:vcz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcz02044]
    VAB027_915
Secretion system [BR:vcz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VAB027_915
SSDB
Motif
Pfam: T6SS_VasE GMP_synt_C
Other DBs
NCBI-ProteinID: AKB06156
UniProt: A0A023PT89
Position
complement(992344..993678)
AA seq 444 aa
MFARNRVIWNEGLFIKPQHFQQQQRYTEYCLDERLSTVSRYLYGISELSLNPEYLSFGRI
AIERAVGVMPDGTTFRIPQEDHLPDALEVTDASLANQIVYLAVPLRSESLMEINWPEERG
TGRYVSRRLEVRDVHSVQGDTTTIDVSPVRLQLMLEREDRSAYASIAIGRILEKRPDGSV
VLDPDFIPCHLNVVGISALHRFINEMSGLMRERAKNIAQRISSPAQGGVADVSDFMLLQA
LNRLQPQMKHLAELRSLHPERLFECLSCVCGELATFTDESRLPPSLPSYNHDSPSHSFQP
LIRSLRQSLSVVLEPRAVSIQLDKRKYGLMVAPIHDPQLMESAEFIIAVKARMPLDELRR
LFTQQTKVASVEKIRELISLQLPGIPLTPLPVAPRQLPYHAGYTYYQLDKTSAAWAMLTH
SSGFAFHVAAAFDDLELQFWAIRS
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgtttgcgcgtaaccgagtgatctggaatgaagggctatttattaagccgcaacatttc
cagcaacagcagagatatacggagtactgcctagacgagcgcctgagcaccgtgagccgt
tacttgtatgggatttccgagttgtcgctcaacccagaatacctctcgtttggccgtatt
gcgattgagcgtgcggtcggcgtgatgcccgatggcaccacctttcgtattcctcaagaa
gatcatcttcccgatgcgctcgaagtgaccgatgcgtcattggcaaaccagattgtctac
ttagccgtaccgctacgtagtgagtcgctgatggagattaactggccagaagagcgcggt
acggggcgctatgtcagccgtcgtctcgaagtgcgtgatgtccacagcgtgcagggtgat
accacgacgattgatgtttcccctgtgcgtttgcaactcatgcttgagcgagaggatcgc
agtgcgtatgcctcaattgctattggccgtattttagaaaaacgtcctgatggcagcgtg
gtgctcgatccggatttcatcccttgtcacttgaatgtggtgggcatctctgcgctgcac
cgctttattaatgagatgtcaggcctgatgcgtgagcgagcgaaaaatattgctcagcgg
atcagctctccagcacaaggtggggttgctgatgtttcggactttatgctgctgcaagct
ttaaaccgtctgcaaccacaaatgaagcatttggcagagctgcgcagcttacacccagag
cgtctgtttgaatgtctctcgtgtgtgtgtggtgagctggctacctttactgacgaaagt
cgtctgccgcccagtttgccaagctataaccatgattcacccagccactctttccagccg
ctgatccgcagcttgcgtcagagcttgagcgtggtgctagagccgcgtgccgtctctatc
caactagataaacgtaagtacggtttgatggttgcgccaatccatgatccgcaactgatg
gagagtgcagagtttatcatcgcggttaaagctcgcatgccgttggatgagctacgtcgt
ctgtttactcagcaaaccaaagtggcatcggttgagaaaattcgtgaactcatctcactg
caactgccgggtattccattgacgccattaccggtcgcaccgcgccaattgccttaccac
gctggctacacctactaccaactggataaaaccagcgctgcatgggcgatgttgactcat
tccagcggttttgcgttccacgttgctgcagcttttgacgatcttgagctgcaattctgg
gctatcaggagctaa

DBGET integrated database retrieval system