KEGG   Verticillium dahliae: VDAG_00075Help
Entry
VDAG_00075        CDS       T03450                                 

Definition
(RefSeq) hypothetical protein
  KO
K22644  voltage-gated hydrogen channel 1
Organism
vda  Verticillium dahliae
Brite
KEGG Orthology (KO) [BR:vda00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:vda04040]
    VDAG_00075
Ion channels [BR:vda04040]
 Voltage-gated cation channels
  Proton channel, voltage-gated (Hv)
   VDAG_00075
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Herpes_BLRF2 Hanta_nucleocap
Motif
Other DBs
NCBI-GeneID: 20701538
NCBI-ProteinID: XP_009649747
UniProt: G2WR92
Position
2
AA seq 208 aa AA seqDB search
MPRTDDTQLPLLGDTINEHPEQGLPEAALHEPQQRAQLPQLLSSRRKHMVVLILVALDVA
ALLANIFIELVECDRRNEKLQRPAWTGNARQALTTAGLVFSSLFLLELVFCIVAFGLNHH
VVDHQTGYLKDWFHCLDAVVIVTSFVVDLLSHGIVEDIASLVIVFRLFRFAKMLEEMSMG
AAERIESMANELDKLRMENTLLKERHQV
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgcctcggacagacgacacgcagctgccccttctgggcgataccatcaacgagcatccc
gaacaaggactgccagaagcagccttacacgaacctcagcagcgagcccagcttccgcag
cttctttcatcgaggaggaagcacatggttgtgcttatactcgtcgcgctggacgtggcg
gccttgctcgcgaacatcttcatcgagctggtggaatgcgaccgccgcaacgagaagctc
cagaggccggcatggacaggcaacgcgcgccaagccctcacgacggctggactggtgttc
agcagcctgttcctgctcgagttggtcttctgcatagtggctttcgggcttaaccaccat
gtggttgaccatcaaaccgggtatctcaaagactggttccactgcctcgacgcggtagtc
atcgttacgagcttcgtcgtcgacctactgtcccacggcatcgtcgaagacattgcatca
ctggtcattgtgttccgcctcttccgctttgccaagatgctcgaggagatgagcatgggc
gctgccgagcgtatagagagcatggccaatgaactcgacaaactgcgaatggagaacacc
ctgttgaaggaaaggcatcaagtgtga

DBGET integrated database retrieval system