KEGG   Verticillium dahliae: VDAG_00734Help
Entry
VDAG_00734        CDS       T03450                                 

Definition
(RefSeq) cytosolic phospholipase A2 zeta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
vda  Verticillium dahliae
Pathway
vda00564  Glycerophospholipid metabolism
vda00565  Ether lipid metabolism
vda00590  Arachidonic acid metabolism
vda00591  Linoleic acid metabolism
vda00592  alpha-Linolenic acid metabolism
vda01100  Metabolic pathways
vda01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vda00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    VDAG_00734
   00565 Ether lipid metabolism
    VDAG_00734
   00590 Arachidonic acid metabolism
    VDAG_00734
   00591 Linoleic acid metabolism
    VDAG_00734
   00592 alpha-Linolenic acid metabolism
    VDAG_00734
Enzymes [BR:vda01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     VDAG_00734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B PEX11
Motif
Other DBs
NCBI-GeneID: 20702197
NCBI-ProteinID: XP_009650406
UniProt: G2WQU2
Position
2
AA seq 814 aa AA seqDB search
MRSIVTFIRSSVGHVRWFHSQRKGFDALSTHRLASKQFRTGFFTTTPQDEAKKKTRGIPT
VPAVIIAGGLFVWALYPSEEFDQISEAQTYRRERQLQRKRDKEKLEREEEQERQDRQAAK
NGSSAAWNTFSSSFEAFSDAADIEWSSLSDRVVGFILPEWSKQIPGFVRKLQRELSLAPG
SLADEIWRDAHDPFINPEIRHEATVRISTDLCDDEKEFLARRKMVTRVALAKYLEIDENE
IHPDDVPVIAMCGSGGGLRALVAGSGSLHAADQDGLFDCVTYTSGVSGSCWLQTLYFSSV
GGRSFPRILEHLKSRAAIHIAYPPVAFQAIVSAPTSKYLLSGLVEKLRGDPQASFGLVDI
YGLLLAARFLVPKGELEVCDSDFKLSNQRQYIKYGQNPMPIYTAVRHEIPGIDDNEPIDS
VEAAKEKAAREAWFQWFEITPYEFFCEEFSAGIPTWALGRKFNNGVDVPPEEGFHLPEVR
VPFLMGVFGSAFCATLSHYYREVRPLVQSLSGFMNLDEIISGRYNNDLEKVHPIDPGTVA
NFAYGMHGRLPDTTPPSIYDNEYIQLMDAGMSNNLPLYPLMRPGRGVEVLIAFDASADTK
MDNWLAVADGYARQRKIKGWPVGIGWPKPGEAPEELTKELENAEASDLKDADRRLNEAQV
EQKKTPGKNTTDDLGYCTVWVGTSQERSTSPPPPSRALDESTHWHISEPDAGIAVVYLPL
LGNPEAVPGVSPGESDFLSTWNFVYTPEQIDQVVDLARANYAQGQRQIRETVRAVYLRKK
KLREAKEKERKSERYRGLVRRGMGTRLGEGDQFS
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcgatcgttaccttcatacgctcctcagtgggccatgtgagatggtttcattct
cagcggaaaggctttgatgccctttcaacacaccgattggcgagcaagcaattccgcacc
gggttcttcaccaccacccctcaagacgaggctaagaagaagacccgaggcatccctact
gtccccgctgttattatcgctggcggactgttcgtctgggctctctatccttccgaagaa
ttcgaccaaatctcggaggctcagacttaccgccgtgagcgacagctccagcgaaaacgc
gacaaagagaagctggaaagagaggaagagcaggagcgccaagaccgacaagcagcgaag
aacggttcgtcggccgcgtggaacacattctcttccagctttgaagctttctccgatgcg
gctgatatagaatggtcttccctctccgaccgagttgttggctttatcctcccggagtgg
tccaagcaaattcctggtttcgtccgcaagctgcagcgtgagttgtccttggcgcctggg
tctcttgccgatgagatatggcgtgacgcccacgatcccttcatcaaccccgaaatccgc
catgaggcgactgtccgcatctcgactgatctctgcgacgatgagaaagagttcctcgcc
cggcgaaagatggtcacacgagttgccctggccaagtatcttgagattgacgaaaacgaa
attcatcccgacgatgtccccgttattgccatgtgcggctctggtgggggcttacgagct
ctggtcgctggctctggttctcttcatgcagccgatcaagacggactcttcgactgcgtc
acctacacttccggtgtttccggctcctgctggcttcagaccctctacttctcctccgtt
ggcggccgcagcttcccccgcatcctggagcatctcaagtctcgtgccgccatccacatc
gcctacccacccgttgcctttcaggctattgtctctgctccaactagcaaataccttttg
agcggcctggtggagaagctgcgcggcgaccctcaagctagttttggccttgtcgatatt
tacggtctgcttctggccgcccgatttctcgttccgaagggtgaacttgaggtctgcgac
agtgacttcaagttgagcaaccagcgccaatatatcaaatatggacagaatcccatgcca
atttacacggcagttcgccacgaaatcccaggtatcgatgacaacgagcccatcgatagc
gttgaggccgccaaggagaaggccgctcgagaggcatggtttcagtggtttgagatcacg
ccgtatgagttcttctgcgaagaattctcagcaggaataccaacctgggcccttggtcgt
aaatttaacaacggtgtcgatgtacctcctgaagagggcttccatctgccagaggttcgc
gtgccgttcctcatgggtgtcttcggctcagctttctgcgcaacactcagccactactac
cgcgaagtccgaccccttgttcagtctctttcgggtttcatgaacctcgatgagatcatc
tctggtcgctacaacaacgacctcgagaaggttcaccccattgacccagggactgtcgcc
aactttgcctacggcatgcacggccgactccctgacaccactccaccgagcatctatgat
aatgagtacatccagctcatggatgctggcatgagcaacaacttgcccctttaccctctc
atgcgccctggacgtggtgttgaggttctcatcgcgtttgatgcctccgctgatacgaag
atggataattggcttgccgtcgcagatggctatgctcgtcaacgcaaaatcaaaggctgg
cccgtcggtattggctggcccaagcctggcgaggcacccgaagaactcacaaaagagctt
gaaaatgccgaggcttccgatttgaaggatgccgacagaaggctcaacgaagcgcaggtc
gaacagaagaaaaccccaggcaaaaacacaactgacgatctggggtactgtaccgtttgg
gtgggaacgtcgcaggagcggtccaccagcccgcctccgccatccagagctctcgatgaa
tcgacgcactggcacatctctgagccggacgcggggatcgcggttgtgtacttgccactc
ctcggcaatccagaagccgtgccaggtgtcagtcctggcgagtcggacttcttgtcgacc
tggaactttgtctacacgcccgagcagattgaccaggtcgttgatctagcccgcgccaac
tatgcacaaggccaaaggcaaattcgcgagacggtgagggcggtctatttgcggaagaag
aagctcagggaggccaaggagaaagagcgaaagtcagagcgataccggggcctcgtcaga
cggggaatggggacgagattgggcgagggcgatcagttcagttga

DBGET integrated database retrieval system