KEGG   Verticillium dahliae: VDAG_01448Help
Entry
VDAG_01448        CDS       T03450                                 

Definition
(RefSeq) ketohexokinase
  KO
K00846  ketohexokinase [EC:2.7.1.3]
Organism
vda  Verticillium dahliae
Pathway
vda00051  Fructose and mannose metabolism
vda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    VDAG_01448
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vda04147]
    VDAG_01448
Enzymes [BR:vda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.3  ketohexokinase
     VDAG_01448
Exosome [BR:vda04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VDAG_01448
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB Sushi_2
Motif
Other DBs
NCBI-GeneID: 20702911
NCBI-ProteinID: XP_009648629
UniProt: G2WUH5
Position
1
AA seq 315 aa AA seqDB search
MTPHQATQHIVLVGACYLDTILRQGTSVPRYPREDEKLRATELQVRHGGNCPNSLQVLRQ
LLAAEGALASRPASETQLHLVSLLPQRDSPATEQILASFGRGPSPPVDFDHCLFRAGHMA
PASCYVLRSAATGSRTIVNSNKLPDMTVREFAAIVTAMTGRAGTGRDAGRWWWHFEGREP
ATTLACMRVLRRELGESVLISVEVEKPGREGLRALAAEADVAFFSKSWAEDCGYTSSEAC
LLGERPARATVGAGDTFIACVLYGLAHRCDWLNREAVLGFAVDTATLKVQREGFDGLATD
ALANSKHQLHPESSR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgcaccaagcgacgcagcacattgtcctcgtcggggcctgctaccttgacacg
atactcaggcaagggacctccgtgccccgatacccgcgggaagacgagaagctgcgcgcc
acggagctgcaggtccgtcacggtggcaactgtcccaactccctgcaggtgctgcggcag
ctcctcgcggccgagggcgctctcgccagccggccggcgagcgagacgcagctgcacctc
gtctcgctgctgccgcagcgcgacagccccgcgacggagcagatcctcgcgtcgttcggc
cggggcccgtcgcctcccgtggactttgaccactgtctgttccgcgcgggccacatggcg
ccggcgagctgctacgtgctccgcagcgccgcgacgggcagccgcactattgtcaacagc
aacaagctgccggacatgacggtgcgcgagttcgcggccatcgtcacggccatgacgggg
cgcgcgggcacggggcgagacgcgggccgctggtggtggcatttcgagggacgcgaaccg
gcaacgacgctcgcgtgcatgcgcgtgctgcggcgcgagctcggcgagtctgtcctgatc
agcgtcgaggttgagaagccgggccgcgagggcttgcgcgccctggcggctgaggcagat
gtggccttcttttccaagagctgggctgaggattgcggatacacatcgtctgaggcgtgc
ttgctcggggagaggccggctcgtgctactgtcggtgctggagacacctttatcgcatgc
gtcctgtatggcctggctcatcggtgcgactggctgaacagggaggcggtgctgggcttc
gcggtggacacggccaccctcaaagtgcagcgagagggattcgatggactcgccactgat
gcactagccaacagcaagcaccagctccatccagagagttcaaggtga

DBGET integrated database retrieval system