KEGG   Verticillium dahliae: VDAG_03666Help
Entry
VDAG_03666        CDS       T03450                                 

Definition
(RefSeq) urea active transporter
  KO
K20989  urea-proton symporter
Organism
vda  Verticillium dahliae
Brite
KEGG Orthology (KO) [BR:vda00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vda02000]
    VDAG_03666
Transporters [BR:vda02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   VDAG_03666
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SSF
Motif
Other DBs
NCBI-GeneID: 20705129
NCBI-ProteinID: XP_009652045
UniProt: G2X087
Position
3
AA seq 689 aa AA seqDB search
MSSPILHQGVGYGLIVGLSVLFAGFMIVITWSLKRYNSERQTSEMFTTAGRTLKSGLVAS
SVLSTWTWAATLLQSSGVAYRYGVSGPFWYAAGATVQIILFATLAIELKRKAPNAHTFLE
VVRARYGPVTHFVFIAFCCFTNILVTAMLLTGGAAVIENLTGAPTAATVFIFPLGVVVYT
LFGGIKATFITDYVNALVILVSIFIFAFVVYATNGILGSPGAVWDILQEISKERPISGNA
GGSYLTMRSQGGAEFFVINIVGNFGTVFLDNGYYNKAISASPVDALPGYVMGGLSWFAVP
WLTATTMGLAGLALERYDVWPTYPNRLTDAEVTAGLVLPSAAVALLGKGGAIATLLLAFM
AIMSTYSSELIAISSIYSYDIYKTYINPAATGKQIMRMNYIGMTVFALFMGAFSTALYYI
GISMGYLYVLMGVIISSAVIPATLTLLWDGQSWAAATFSPILGLICSLVGWLVTTQVTSG
EITVATSGANTPMLVGNVIALLSPLVFIPLLTYMPPFKPQHYDWQSMLNIRQGSDEEDEA
LDAETAPHEHAVENAAAAAAAAEEERAKLDKSAKFARWLCVGLTLAFLVLWPMPLFGTAY
VFSRKFFTGWVVVGILWLFVSSGIVVFLPLFESRRTIARTSKSMFRDLMGLGRRGRGGAE
VVVQGRHMAGDVTPPVSEGEMTEKAGGKQ
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtccgatccttcaccagggcgtaggctacggcctgatcgtcggcctcagtgtc
ctttttgccggcttcatgattgtcattacctggtctctcaagcgctacaactctgagcgt
caaacttctgaaatgttcacgacggctggccgtaccctcaagtctggtctcgttgcttcg
tccgtcttgtccacctggacatgggcagcaaccctgctgcaaagttctggtgtcgcctac
cgatatggtgtctccggtcccttttggtacgccgccggtgccaccgtccagatcatcctg
tttgcgactctcgccatcgaactcaagcgcaaggcgcccaacgcgcacaccttcctcgaa
gtcgtccgagcccgctatggacctgttacccactttgtctttatcgccttctgctgcttc
accaacattctcgtcacggccatgctgctgacgggcggtgctgccgtcattgagaacctg
acgggggccccgactgctgccaccgtcttcatcttccccctcggtgtcgttgtgtacacg
cttttcggcggtatcaaggccaccttcatcaccgactacgtcaacgcgctcgtcatcctg
gttagcatcttcatctttgcgttcgtcgtgtacgcgaccaacggcatcctgggttcgccc
ggtgccgtgtgggacattctgcaggagatctccaaggagcgacccatcagcggcaacgcc
ggcggcagctacctgaccatgcgctcacagggtggcgctgagttcttcgtcatcaacatt
gtcggcaactttggcaccgtcttccttgacaacggttactacaacaaggccatctctgct
tcgcctgttgacgctcttcccggctacgttatgggcggcctcagctggtttgcggtcccc
tggctgacagccaccaccatgggtctcgccggtctcgcgctcgagcgctacgacgtctgg
cccacctaccccaaccgcctcaccgacgccgaggtcaccgccggcctcgtccttcccagc
gccgccgttgctctgctcggaaagggcggtgccatcgccacactgctgctcgccttcatg
gctatcatgagcacgtattcgtccgagctgatcgccatctcgtccatctattcgtacgac
atttacaagacgtacatcaaccctgcggccactggcaagcagattatgcgcatgaactac
atcggcatgaccgtctttgctctcttcatgggcgccttctccacggccctctactacatt
ggcatctccatgggctacctctacgtcctcatgggcgtcatcatctcgtcggccgtcatc
cccgcgacactcactctcctctgggacggccagtcgtgggcggccgccacattttcgcca
atcctcggcctcatctgctcgctcgtcggctggctcgtcacgacgcaggtcacctcgggc
gagatcacggtggcgacgtcgggcgccaacacgcccatgctcgtcggcaacgtcattgcc
ctcctctcgcccctcgtcttcatcccgttgctgacctacatgccgccgtttaagccccaa
cactacgactggcagtcgatgctcaacattcgccagggcagcgacgaggaggacgaggcg
ctcgacgccgagacggcgccccacgagcacgccgtcgagaacgcggcggccgcggcggcg
gccgccgaggaggagcgggccaagctcgacaagtcggccaagtttgcgcgctggctctgc
gtcgggctgacgctcgcgttcctcgtgctctggccgatgcccctcttcggcacggcgtac
gtcttcagccgcaagttcttcaccggctgggtcgtcgtcggcatcctgtggctgtttgtg
tcgtcgggcatcgtcgtgttcctgccgctgttcgagtcgcgccgcaccattgcccgcacg
tccaagtccatgttccgcgacctcatgggcctcgggcgtcgcggcaggggcggcgccgag
gttgtcgtgcagggcaggcacatggcgggcgacgtgacgccgccggtgagcgagggcgag
atgacggagaaggcgggcgggaagcagtag

DBGET integrated database retrieval system