KEGG   Verticillium dahliae: VDAG_03792Help
Entry
VDAG_03792        CDS       T03450                                 

Definition
(RefSeq) beta-fructofuranosidase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
vda  Verticillium dahliae
Pathway
vda00052  Galactose metabolism
vda00500  Starch and sucrose metabolism
vda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vda00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VDAG_03792
   00500 Starch and sucrose metabolism
    VDAG_03792
Enzymes [BR:vda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     VDAG_03792
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF4975
Motif
Other DBs
NCBI-GeneID: 20705255
NCBI-ProteinID: XP_009652171
UniProt: G2X0L3
Position
3
AA seq 680 aa AA seqDB search
MAALKITSAVTAITSLAALATPAFAQDLSAEYPTLTTDILEGLGNSSLFTRWRPRSHYMS
PHSWMNDPCGPLYDPTTETYHLHYQYHPNHVNWGNISWGHAVSKDLFHWTDVRDWANDSA
VSLASGKYPSGPLSQFTGTSQPVNLQGEQDGTILTFATGIQFLPTNWKIPYTNGTEVQAL
YTSSDGGLTWEEVGTVLDGPPDGWNVTGWRDPSFFPSTLLDELLSVDEPHYYMVLGSGLK
GGDVPFPLPGAERPGFLGPRIPLYAAPASNLEAWEFLGALWEPAANSSLGVPDVTGSYGY
NFEVSSLFELDTPSGGKAWFFGAGAEGGNTTTHWREQWALWNRGEVSARENGSVAFAPNS
GGALDWGMAYAQATWNDTKENRRVMWGWAIEEVNDAYVFNTTKQLGYNGVMTLPTELFVK
ETKNVLNCDVQPDGNLCVKQKDGSFTAETLGLRPLPDVLDLMRNGSEAHDFDVGELHSTH
HRAVTHAGSSYELKATLSNFNGTAGILVAQSPDHAEYTVIYLDPETKQIGVNRDHSSLLP
HFGNRTFVGHFEAYEIRESGSNKTTTEDVNFHVVVDGSLLEVWVNERFAMTARMYPSRSD
STGISFFAGSWENKEAGGGCKQSAEGDEEEDAEVIQASWSNVQVWKGLSNAWPDRPSDSS
VQLVWDSPEDTNNYTWWAGY
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggcggccctcaagattacttcggccgtgacggccatcacatccctcgcagctttggcg
actcctgccttcgcacaagacctatcggccgagtatccgacgctgacgaccgacatcctc
gagggcctgggcaacagctccctgtttacccgctggcgccctcgttcgcattacatgtca
cctcactcatggatgaacgatccgtgcgggcctctctacgacccgactacagagacttac
cacctgcactaccagtatcaccccaaccacgtcaactggggcaacatctcctggggccat
gccgtctccaaggaccttttccactggaccgatgtgcgcgactgggccaacgactcggcc
gtgagcctggcctcgggcaagtacccctctggccctctgtcgcagttcaccggcacctct
cagccggtcaacctgcaaggtgagcaggatggaactattctcacctttgctactggcatc
cagttcctcccgaccaactggaagattccctacaccaacggcacagaggtccaggccctt
tacacgtcctccgacggtggcctcacctgggaggaggttggcactgtgcttgatggcccg
ccggatggctggaacgtcaccggctggcgtgatcccagcttcttcccgtcaaccctcctc
gacgagctactctcggttgacgagccgcactattacatggttcttggctctggtctcaaa
ggtggcgatgtccccttcccgcttcccggtgccgagcgcccgggattcctcggaccccgc
atcccgctgtacgcggcgccagcgtcgaacctcgaggcatgggagttcctcggtgccctt
tgggagccggcagcgaacagctcactcggtgtgcctgatgtcacgggctcctacggctac
aactttgaggtcagcagcctgttcgagctcgatacgccttcgggtggcaaggcgtggttc
tttggtgcaggagccgagggcggcaacacgacaacgcactggcgcgagcagtgggcgttg
tggaaccgcggcgaggtgtcggcgcgggagaacggttcggtcgcgtttgcgcccaactct
ggcggcgcgctggactggggtatggcctacgctcaggcaacatggaacgacaccaaggag
aatcgtcgcgtcatgtggggttgggcaatcgaagaggtcaacgacgcgtacgtcttcaac
acgacgaagcagctgggctacaacggcgtcatgacgctgccgaccgagctgttcgtcaag
gagaccaagaacgtcctgaactgcgatgtgcagccagacggcaacctctgtgtcaagcaa
aaggatggcagcttcacggcggagaccctcggcctgcgacctcttcccgacgtgctcgat
ttgatgcgaaacggcagcgaggcccacgactttgacgtgggtgaactccacagcactcac
caccgggcagtgacccatgccggatcatcgtacgagctcaaggcgacgctcagcaacttc
aatggcacggcgggtatcctggttgctcagagcccagatcatgccgagtacaccgtcatt
tacctcgaccccgagaccaagcagattggcgtcaaccgcgaccatagcagtcttttgcct
cacttcgggaaccggacgtttgtgggccacttcgaggcgtatgaaatcagggagagcggt
agcaacaagacgacgaccgaagacgtcaacttccacgttgttgttgatggctcgctcctc
gaggtctgggtcaacgagcggtttgccatgacggcacgcatgtacccctcgcgtagcgac
agtactggcatcagcttcttcgcgggaagctgggagaacaaggaggctggtggtggatgc
aagcagtcggcagagggtgatgaagaggaggacgcggaggttattcaggcttcgtggagc
aacgttcaggtatggaaaggtctttcgaatgcctggccagacaggccgtccgattcgagc
gtgcagctcgtgtgggactcccctgaggacaccaacaactacacgtggtgggcgggatac
tag

DBGET integrated database retrieval system