KEGG   Verticillium dahliae: VDAG_03940Help
Entry
VDAG_03940        CDS       T03450                                 

Definition
(RefSeq) long-chain-fatty-acid-CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
vda  Verticillium dahliae
Pathway
vda00061  Fatty acid biosynthesis
vda00071  Fatty acid degradation
vda01100  Metabolic pathways
vda01212  Fatty acid metabolism
vda04146  Peroxisome
Module
vda_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:vda00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    VDAG_03940
   00071 Fatty acid degradation
    VDAG_03940
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    VDAG_03940
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:vda01004]
    VDAG_03940
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vda04147]
    VDAG_03940
Enzymes [BR:vda01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     VDAG_03940
Lipid biosynthesis proteins [BR:vda01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   VDAG_03940
Exosome [BR:vda04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   VDAG_03940
  Exosomal proteins of breast cancer cells
   VDAG_03940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding PsiB
Motif
Other DBs
NCBI-GeneID: 20705403
NCBI-ProteinID: XP_009652319
UniProt: G2X111
Position
3
AA seq 705 aa AA seqDB search
MAPAVDTTALIKKLSVPPPPGSPYGLPIPGSEKEGRSAIYRHWRARDGPLMTTLDPNIQT
MHDTFEAAAQKYPNWRCLGHRAWDPATRDWENKYTWISYSEVAERRKNFGAGLVEVHREL
GETREKYGVGLWSPNRPEWHITDLAAASQSLYTVSLYETLGPETTEYIINHAELTTVVTS
LPHIATLLKLAPRLPTLKALISLDVLDAGEQAGHSKLSVLTDIAANLGIKIYSMADVEAI
GLRSGRHMHPPRPEDLQTINYTSGTTGFPKGVVLTHANAVAAVSGGRAFSTVSHVDIHLS
YLPLAHIYGRMIDAIALAEGASIGFFRGDVLGLVDDMKILQPTGFISVPRLFNRFNSAIK
VATVQADGFKGALSRRAIDTKKASMKLPAGKAHNTHFLYDKIWTPKVRAAVGLTKAHSMI
SGSAQLDPEVQEFLRAAFGNNFMQGYGLTESYAVSSIQHKTDFSTGNIGAPCYCNEICLE
SVPDLEYNVTDKPNPRGELLLRGPNIFKEYYKNPEETAKAIDAEGWFHTGDIAEVDSLGR
FKIVDRKKNVLKLSQGEYISPERIENVYLGSSSLLATAYVHGDPQQSTLVAVFGIDPENF
APFASKQLKKTIDKTDTAALKAAAQDPKVKKALLAEIDKIGRNHKFNSYERVRAIHLAID
PFTIDNELLTPTLKLKRPQTARAFRAEIDRMYTEVEAETSTKAKL
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atggctcccgccgtcgacaccaccgcgctcatcaagaagctgtctgtgcccccgccgccc
ggctctccctatggcctacccatccctggctccgagaaggagggtcgttccgccatctac
cgccactggcgcgcccgcgacggtcctctgatgacaaccctcgaccccaacatccagacc
atgcacgacacctttgaggctgccgctcaaaagtaccccaactggcgctgcctcggccac
cgtgcctgggatccggcgacgcgcgactgggagaacaagtacacctggatttcctacagt
gaggtcgccgagcgccgcaagaactttggcgctggtcttgtcgaggttcaccgcgagctc
ggtgagacccgagagaagtatggtgtcggcctgtggtcgccgaaccgccccgagtggcac
atcaccgatctcgctgctgcctcgcagtctctatataccgtttctctctacgagaccctg
ggtcccgagaccaccgagtacatcatcaaccacgccgaactgaccaccgtcgtcacctcg
ctgccgcacattgccaccctcctgaagctcgctccgagactgcccaccctcaaggccctt
atctcgctcgatgtcctcgatgccggtgaacaggccggccactccaagctctccgtcctg
accgacattgctgccaaccttggcatcaagatctactccatggccgatgtcgaggccatt
ggtctccgctctggccgccacatgcacccccctcgccccgaggatctccagaccatcaac
tacacatccggcaccaccggattccccaagggtgttgtcttgacccacgccaacgccgtc
gctgccgtgtccggcggcagggccttctctaccgtttctcacgtcgacattcacctgtcc
taccttcctctggctcatatctacggccgcatgattgatgccattgccctggcagaaggt
gccagcatcggcttcttccgcggcgatgtcctcggcctcgtcgatgatatgaagattctg
cagcccaccggcttcatctccgtacctcgcctcttcaaccgcttcaactcggctatcaag
gtggccacggttcaggccgacggcttcaagggcgctctgtctcgccgcgccatcgacacc
aagaaggcctcgatgaagctgcccgctggcaaggcccacaacacgcatttcctctacgac
aagatctggacccccaaggtcagggcggctgtcggtctcaccaaggctcacagcatgatc
agcggcagtgctcagctcgaccctgaggtccaggagttcctccgcgctgcgttcggcaac
aacttcatgcagggatacggtctcaccgagtcgtacgccgtgtcctctatccagcacaag
acagacttctccaccggtaacattggcgccccttgctactgcaacgagatctgcctcgag
tccgttcccgacctcgagtacaacgtcaccgacaagcccaaccctcgcggtgagctgctt
ctccgcggacccaacatcttcaaggagtactacaagaaccccgaggagacggccaaggcc
atcgacgccgaaggctggttccacacgggcgacattgccgaggtcgacagcctcggccgc
ttcaagattgtcgaccgcaagaagaacgtcctcaagctctcccagggcgagtacatctcc
cccgagcgcatcgagaacgtctacctcggcagctccagccttctcgccacggcctacgtc
cacggcgacccccagcagtccacgctcgtcgccgtctttggcatcgaccccgagaacttt
gcgccatttgcgagcaagcagctcaagaagaccatcgacaagaccgacacggccgccctc
aaggccgccgcgcaggaccccaaggtcaagaaggcgctgctcgccgagattgacaagatt
ggccgcaaccacaagttcaacagctacgagcgcgtgcgcgccattcacctggccatcgat
cccttcaccatcgacaacgagctcctgacaccgacgctcaagctcaagagaccgcagacg
gccagggccttccgcgccgagattgaccgcatgtacaccgaggttgaggccgagacctcg
accaaggccaagctgtaa

DBGET integrated database retrieval system