KEGG   Verticillium dahliae: VDAG_05108Help
Entry
VDAG_05108        CDS       T03450                                 

Definition
(RefSeq) vacuolar aminopeptidase
  KO
K01268  aminopeptidase I [EC:3.4.11.22]
Organism
vda  Verticillium dahliae
Brite
KEGG Orthology (KO) [BR:vda00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:vda01002]
    VDAG_05108
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vda04131]
    VDAG_05108
Enzymes [BR:vda01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.22  aminopeptidase I
     VDAG_05108
Peptidases [BR:vda01002]
 Metallo Peptidases
  Family M18
   VDAG_05108
Membrane trafficking [BR:vda04131]
 Autophagy
  Cytoplasm to vacuolar targeting (CVT) pathway
   Selective cargos
    VDAG_05108
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M18
Motif
Other DBs
NCBI-GeneID: 20706571
NCBI-ProteinID: XP_009653139
UniProt: G2X4M6
Position
4
AA seq 542 aa AA seqDB search
MASSPATDTDQQTARLPTREYLLADMAGRSRQENPVCTPCFLTLRSVDQPHVRLGSPAEC
RLCAVSAGKPEAYTKPFCDFLTENPTIFHTVAYFKTKLADAGFHELSARANWAGKLEPGG
KYWTTRNGSALIAFTVGQKYEPGNGVAMIAGHIDALTARLKPVSTKRNAAGYVQLGVAPY
AGGLNATWWDRDLSIGGRVVVRDPDRGKTSTRLVKLGWPIARIPTLAPHFGVGMMGQNNP
ETQAVPIIGLDNSDLGGADTSEAPAGPPGSFAATQPPKLVKLIARELRTSASAILNWDLE
LYDAQPAQTGGLDREFIFAGRVDDKLCSWAAFTALLAADAAPDDGTIKLVALFDDEEIGS
LLRQGARGNFLPSTVERAVEALAAKSQALAARDHHAFGPGLVAQTYAASFLLSADVTHAG
NPNFLAYYLDQHVPRLNVGLVICGDANGHMTTDAVSTAILQRIGDLAGCRTQTFQIRNDT
RSGGTVGPMLSSALGVRAADAGLPQLSMHSIRATTGSLDPGLGVKFFKGFLDHWEKVDAE
WQ
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggcatcatcccccgccactgacaccgaccaacagacggctcgtctgccgacacgcgaa
tacctcctggccgacatggctggccgctcgcgccaggagaaccccgtctgcacgccatgc
ttcctgacgcttcgctctgtcgaccagccccacgtcaggctgggctcgccagccgagtgc
cgcctctgtgccgtgtccgccggcaagcccgaggcctacacgaagcccttctgcgacttc
ctcaccgagaaccccaccatcttccataccgtcgcctacttcaagacgaagctcgccgat
gccggcttccacgagctctccgcccgcgccaactgggccggcaagctcgagcccggcggc
aagtactggaccacgcgcaacggcagcgccctcatcgccttcaccgtcggccagaagtac
gagcccggcaacggcgtcgccatgatcgccggccacattgacgccctgaccgcgcgcctc
aagcccgtcagcaccaagcgcaacgctgccggctacgtccagctcggcgtcgccccctac
gccggcggcctcaacgccacctggtgggatcgcgacctcagcatcggcggccgcgtcgtc
gtccgcgaccccgacaggggcaagacgtccacccgtctcgtcaagctcggctggcccatt
gcccgcatccccacgctcgccccgcactttggtgtcggcatgatgggccagaacaacccc
gagacccaggccgtgcccatcatcggcctcgacaactcggacctcggaggcgccgacacc
tcggaagcgcccgccggtccgcccggctccttcgccgccacccagcccccgaagctcgtc
aagctcatcgcccgcgagctccgcacctccgcctcggccatcctcaactgggacctcgag
ctctacgacgcacagcccgcccagaccggcggcctcgaccgcgagttcatctttgccggc
cgcgtcgacgacaagctctgcagctgggccgcctttacggcgctgctcgccgccgacgcc
gcgcccgacgacggcaccatcaagctcgtcgccctcttcgacgacgaggagattggctcg
ctgctgcgccagggcgcccgcggcaacttcctgccctcgaccgtcgagcgcgccgtcgag
gccctcgccgcgaagagccaggccctcgccgcaagggaccaccacgcctttggccccggc
ctcgtcgcccagacgtacgccgcctcgttcctcctcagcgccgacgtcacccacgccggc
aaccccaacttcctcgcctactacctcgaccagcacgtgccgcgcctcaacgtcggcctc
gtcatctgcggcgacgccaacggccacatgaccaccgacgccgtctcgaccgccatcctc
cagcgcatcggcgacctcgccggctgccgcacccagaccttccagatccgcaacgacacg
cgcagcggcggcaccgtcgggcccatgctcagcagcgccctcggcgtgcgcgccgccgac
gccggcctgccgcagctcagcatgcacagcatccgcgcgacgaccggcagcctcgacccc
ggtcttggcgtcaagttcttcaagggcttcctcgaccactgggagaaggtcgatgccgag
tggcagtga

DBGET integrated database retrieval system