KEGG   Verticillium dahliae: VDAG_05810Help
Entry
VDAG_05810        CDS       T03450                                 

Definition
(RefSeq) separin
  KO
K02365  separase [EC:3.4.22.49]
Organism
vda  Verticillium dahliae
Pathway
vda04111  Cell cycle - yeast
vda04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:vda00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    VDAG_05810
   04113 Meiosis - yeast
    VDAG_05810
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:vda01002]
    VDAG_05810
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:vda03036]
    VDAG_05810
Enzymes [BR:vda01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     VDAG_05810
Peptidases and inhibitors [BR:vda01002]
 Cysteine peptidases
  Family C50: separase family
   VDAG_05810
Chromosome and associated proteins [BR:vda03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Separase
    VDAG_05810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT
Motif
Other DBs
NCBI-GeneID: 20707273
NCBI-ProteinID: XP_009653502
UniProt: G2X6M8
Position
4
AA seq 2187 aa AA seqDB search
MTSLQNKVDAVKAAITPTTTCTSATTVLLKDLLITESDHHTSSLPPSTTTTTTTASSNAA
SKPTRGASARPKTPSTTRQRAPTTTTTTTKPTAARQPKPENDLSSKEKAALATHVVNAGL
KALTETAKPAPTAPPSQPPTEPAPPRKRPDAAEPRRGLRRSSSMPMPPLQPRALNRVSTS
PMLPKTATGRPQSAHGGGGGGGGGGAAPASSSSFAAACLPLVECLRVAFACLRSLHAAGK
VTLPEGQLEAGMSSFVTKLLGLGLQDHALRELAVLKRSLAQLDAAKPSTKTDKAVAAASH
ANTLATNPAHLLDYGAIKASGAILGLVITSQLHALRLVAAAKKPAMIEAAVPFLGDHPSS
PMNLLSRYAKESAAAKNKAARQLEQFSQLILSLPPSVSSKEDALAAENRLSCSPTAALQL
HSLGFEYRLCWWAMAGHEADVDGDLMLPLSRCMAAFVRRCATPTPAAFQVARGAYTRITD
LCAHQRLQPSTSAASPLAAIYQTLGTLAQSARLFTEAATWLTLVKGHLDPEQSSAAKRCS
VAAQLLAVQAKREDTPTQELESLLQEIIGELKGTLKGDSAELEELMINLTAARRSTVGLL
VHKESSLPRPMTASCHDFVLQFPHFALRWMGKAPARDADAKHTIRYDQRRQTLLATATQI
MDSAFVVLKAKISKDDMPWAQLDGTLQDCLTLLEHLGETNLLQKSDGANTYPVKVSSLYY
YHADRVQRGGGTEKEDGKAVLRPIKRSIEAVADRSPREKERAQLVKKLERFSELSRASGR
LAEARDARKAICTNMVEDGVLAAVAASLNDKAPALAWRADAKTEALSRTLAAMVKLDQAW
SDWTFFLAELERAAVLEHLIQIIVSDAAKGSGGGSSSSSKPTGLSSSVPDALLRLYSLER
FPVRRLRTLCLLLAMSMGEQHEFQSLRVQVNATLDACRSSAFGDDASLAKFLPHHEAHLA
SMIALIDTDPASATNDLEAPVAAWRAMIARCTSVDDMYACIDDPEQLLRHLGSVEAFANL
RGDDVLRLAVLELSTDLTRLMTSSSINTVLLSHSALADHYLDLGHEAKAKDMLARAALLA
TPDESEAGPLSGSEVAWVSLQLSSVEYHLAAHNHVEAEAALAEAKAAFDKQTTPPKGSSL
QRRLLLARATYVYSLVAMGKGETHQALNYAKNNVKLLYSSWAKLEARSPAASHESSQLSI
ATSSADEDDGGSSLQKSTTGSSSSSSSILHVADGPDYWALACALLRSMFHLSSVYVHIGM
FQETLYYAEKALSIAESIDSLAHKTQAQSWIGSVWIRANKPEKGLNLLQRARETLGSQKP
SRRAMRLACELSASYGLLKDRQSEEELFGTAEAMLKTLGGAGVVGGSANDDVVEKMQKLT
LDDAATATKTARAARTTRATRTTRTAAAAPKAAAKKPTTTATRTRAAAPKTRTAAAADVA
PKATPKSPALQTSMLISKALVHLDKKDWAAAMELLDESQKTSVGLRQSLTVQVHRAACLI
GQSLEEMLHDSVFSVVQESTISFPAVAAIAGTDKHAADKAAAASPPARKSRARAATLQKD
ARPDTSFGFVESLQKALEYLVEAHSMAFVTGDGHLVLRISALLQNTTIFLSAASNHTAKS
LPHIDFATCSMELARNVTWRRTRKMIAVEQSDAPFSDISWPTALALKEGRRLSCGVTTDV
ARFQRDYVNIIPAAWSVVSISLSENRHDLCITKLQADHTPFVLRLPLERAVSRDADTEVF
DFEQGHGELLEVIRLINESCHDEGRDWSAKGAKAAWWQEREALDKRMKQLLDNIEQIWLG
GFKGIFSQHPRRDDLLSRFQKAFQKTLDKHLPSRRQVRGKKVNTAPKITLDPRILDLFVG
LGDPASPDFDLDEALTDLLYFVVDILQFHGERNAYDEIDFDSIMLETYDALQAYHAGLKS
SDPVQGAHTILILDKALHAFPWESLPCMDGLAVSRVPSMACLRRLILEQQDDAVAGEKTP
AGHTISAKKGTYILNPGSDLPNTLGTFQKPLSTLDATWSSVVSRTPSEAEFEAALRDSDV
LLYFGHGSGAQYIRSKTIRRLDKCRAAALLMGCSSASLTEAGEFEVHGPVWNYMMAGCPA
VVGTLWDVTDRDIDRFAGRLFEEWGLMVRGSFPVDKWSAGPANLDVVATRSVVEAVVKAR
DAVRFRYLTAGAVCVYGIPVYVRPDTR
NT seq 6564 nt NT seq  +upstreamnt  +downstreamnt
atgacttccctccagaacaaggtcgacgccgtcaaggccgccatcacaccgacaacaaca
tgcacctctgcgacgacagtcctcctcaaggacctcctcatcaccgagtctgatcatcac
acatcatcattaccaccatcaacaacaacaacaacaacaacagcctcgagcaatgccgcc
agcaagcccacgagaggcgcgtccgcccgccccaaaaccccctccaccacgcgacagcga
gcgccaacaacgacgacgacaacgacgaaaccaacagccgcgcgccagccgaaacccgaa
aatgacctctcgagcaaggaaaaggccgccctcgccacccacgtcgtcaacgccggcctc
aaagccctcaccgagacggccaaaccagcccccacggcgcctccgagccaaccacccacc
gagccagcgccgccgcgaaagcgccccgacgccgccgagccgaggaggggcctccgacgg
tcgagctccatgcccatgccgcccctgcagccgcgcgccctgaaccgcgtctcgacgtcc
cccatgctgcccaagacggccaccggccggccgcagtcggcccacggcggcggcggcggc
ggcggcggcggcggcgcggcgcccgcctcgtcttcgtccttcgccgccgcgtgcctgccg
ctcgtcgagtgcctgcgcgtcgcctttgcctgcctgcgctcgctgcatgccgccggcaaa
gtgacgctgcccgagggccagctcgaggccggcatgtcctcgtttgtcacgaagctgctg
ggtctcggcctgcaggaccacgcgctgagggagctggccgtcttgaagaggagtcttgca
cagctggacgcggcaaaaccgagcaccaagacggacaaggccgtggccgcggcttctcac
gccaacacactggcgacaaatccggcccatcttctcgactacggcgccatcaaggcctct
ggtgcgattctcggcctcgtcatcacgtctcagctgcacgctctgcgactcgtcgcggcg
gcgaagaaacctgccatgatcgaagcggcggtgccctttctcggcgaccatccctcctca
ccgatgaacctgctgtcgagatacgccaaagagtcggcagcggcgaaaaacaaggcggcg
cgccagctcgagcagttctcccagctcatcctgtccctgccgccaagcgtgtccagcaag
gaggatgccctcgccgccgagaaccgcctcagctgctcaccgacggcggctctccagttg
cactctctcggcttcgaataccgcctctgctggtgggccatggccggacacgaggccgac
gtggacggcgatctcatgctgcccctgtctcgctgcatggcggccttcgtccggcgctgc
gcgacgcccacgccggcggctttccaggtcgcgcgcggcgcctacacgcgcatcaccgac
ctctgcgcacaccagcgcctgcagccctcgacctcggccgcttccccgctggcggccatc
taccagaccctcggcaccctcgcgcagagcgcgcgcctgttcaccgaagccgcgacctgg
ctgacactggtcaagggccacctcgacccggagcagagctcggccgccaaacgctgctcc
gtggcagcgcagctgctcgccgttcaggcgaagcgcgaggacacaccgacccaggagctc
gaatccctgctccaagagatcatcggcgagctcaagggcacactcaaaggcgactctgcc
gagctcgaggagctcatgatcaacctcacggccgcgaggcggtcaaccgtcggcctcctg
gtccacaaggagtcttccctacctcgacccatgaccgcctcctgtcacgactttgtcctg
cagtttccgcactttgccctccgctggatgggcaaggcgccggcgagggacgccgacgca
aaacacacgattcgctacgaccaacgccggcagactctcctcgcgacggccacgcagatt
atggactcggcctttgtcgtcctcaaggccaagatttcgaaagacgacatgccgtgggcc
cagctcgacggaacgctacaggactgcctcacgctgctcgagcacctcggcgagacgaac
ctgctgcagaagagcgacggcgccaacacgtaccctgtcaaggtctcctcgctctactac
taccacgccgatcgcgtccagcgcggcggcggcaccgaaaaggaggacggcaaggccgtg
ctgcggcccatcaagcgctcgatcgaggccgtcgccgaccggtcgccgcgcgaaaaggag
cgcgcccagctcgtcaagaagctcgagcgcttctccgagctctcgcgggcgtctgggcgc
ctcgccgaggcccgcgacgctcgcaaggccatctgcacaaacatggtcgaggacggcgtc
ctcgcggccgtcgcggcgagcctcaacgacaaggcgcccgccctggcctggagggccgac
gccaagacggaggcgctgtcgcgcacgctggccgccatggtcaagctcgaccaggcctgg
agcgactggacgttcttcctcgccgagctcgagcgcgccgccgtgctcgagcacctcatc
cagatcatcgtctcggatgccgccaagggcagcggcggcggcagcagcagcagcagcaaa
ccgaccggcctctcgagctccgtgcccgatgccctgctgaggctctactcgctcgagcgc
ttccccgtccgccggctgcgcacgctctgcctgctgctcgccatgagcatgggcgagcag
cacgagttccagtccctgcgcgtccaagtcaacgcgaccctcgatgcctgccgcagcagc
gcctttggcgacgacgcttccctcgccaagttcctcccccaccacgaggcccatctcgca
tccatgattgctctcatcgacacggatccagcgtcggcgacgaacgatctcgaggcgcct
gtcgcggcgtggcgcgccatgatcgcgcgctgcacatccgtcgacgacatgtacgcctgc
atcgatgacccagagcagctcctgcgacaccttggctcggtcgaggcctttgccaacctg
cgcggcgacgacgtgctccgtctcgccgtcctcgaactatccaccgacctgacccgcctc
atgacaagctcgtccatcaacaccgtgctcctcagccacagcgccctcgccgaccactac
ctcgatctcggccacgaagccaaagcaaaggacatgctcgccagagccgctctgctcgcc
acaccagacgagtcagaggcgggcccattgtcggggtcggaagtggcctgggtgagcctc
cagctgtcctcggtcgagtaccacctcgccgcgcacaaccacgtcgaagccgaggccgct
ctcgcggaggccaaggccgcgttcgacaagcagacgacgccgccaaagggctccagcctg
cagcggaggctgctcctcgcgcgcgcgacctacgtgtactcgctcgtcgccatgggcaag
ggcgagacgcaccaggccctcaactatgccaagaacaacgtcaagctcctgtactcgagc
tgggccaagcttgaggcccgcagccccgccgcctcgcacgagtcttcgcagctgtccatc
gccaccagctccgccgacgaggatgacggcggcagcagtctccagaagagcacgacaggc
agcagcagcagcagcagcagcatcctccacgtcgccgacgggcccgactactgggccctc
gcctgcgccctcctgcggagcatgttccacctgtcgtccgtctatgtgcacattggcatg
ttccaggagacgctctactatgcggaaaaggccctgtcgatcgcagaatccatcgactcg
ttggcccacaagacgcaggcgcagagctggatcgggtccgtgtggatcagggccaacaag
cctgagaaggggctcaacctgctccagcgagcgcgggagacgctcgggtcgcagaagccg
tcgcggcgagccatgcgcctggcgtgcgagctcagcgcctcgtacggtttgctcaaggac
cggcagagcgaggaggagctgttcggcacggcggaggccatgctcaagacgctcggcggc
gccggcgtcgtcggtggttctgcgaacgatgatgtggtggagaagatgcagaagctcacc
ctcgacgatgcggctaccgcgacgaagaccgcgcgagccgcccgcacgacgcgcgccacg
aggacgacacgaactgctgcggcggcacccaaagctgcagccaagaagcctaccacgaca
gcaacaaggacgagggctgctgcgcccaagacgagaacagccgccgccgccgacgttgct
cccaaggccacacccaagtctcccgcgctgcagacctcgatgctcatcagcaaggcactc
gtgcacctcgacaagaaggactgggcggccgccatggagctgctcgacgagtcgcagaag
acgtccgtcgggttgaggcagtctctcaccgtgcaggtccacagggcggcctgtctcatc
ggacaaagcctcgaggagatgctccacgattccgtcttctccgtcgtgcaggaatccacc
atttcctttcctgccgtcgccgccattgccggcaccgacaagcatgccgcagacaaggcg
gccgctgcctcgccacctgctaggaaatcgcgcgcgcgagccgccacgctgcagaaagac
gccaggcccgacaccagcttcggctttgtcgaatcgctgcaaaaggcgctcgaatatctt
gtcgaggcgcactcgatggccttcgtcacaggcgacggccacctcgtgctccgcatctct
gctctcctgcagaacacaacaatcttcctctcggcggcctcgaaccacacggccaagagc
ctgccgcacattgactttgcgacctgttccatggagctggcgcgtaacgtgacgtggcgg
cgcacgcgcaagatgattgccgtcgagcagagcgacgcccccttcagcgacatctcgtgg
cccacggccctcgccctcaaagagggccgtcgactgagctgcggcgtgacgaccgacgtg
gcccggttccagcgcgactatgtcaacattatcccggcggcctggagcgtcgtgtccatt
tcgctcagcgagaaccgtcacgacctgtgcatcaccaagctgcaagccgaccacacaccc
tttgtcctgcgcttgccgctcgagcgtgccgtctcgcgtgacgccgacacggaggtcttc
gactttgagcagggacacggcgagcttctcgaggtcatccgcctcatcaacgagagctgc
cacgacgaaggacgcgactggtctgccaagggagccaaagccgcgtggtggcaagagaga
gaggctctcgacaagcgcatgaaacagctcctcgacaacatcgaacagatctggctcggg
gggttcaagggtatcttctcgcagcacccgcgccgcgacgacctgctgtcacggttccaa
aaagccttccagaagacgctcgacaagcacctcccgtcacggaggcaggtgcgcggcaag
aaggtcaacacggcgcccaagattaccctcgacccgcgcatcctcgacctgtttgtcggc
ctgggcgatcccgcttcgcctgatttcgacctcgacgaggcgctgaccgaccttctttac
ttcgtcgttgatatcctgcaattccacggggagaggaacgcctacgacgagattgacttt
gactccatcatgcttgagacgtacgacgcactgcaggcatatcatgcaggtctgaagagc
tcggatcccgtccagggggcacacaccattctcatcctcgacaaggccctacatgccttt
ccctgggagtcattgccctgtatggacgggctcgccgtctctcgcgtcccctccatggca
tgtctccgccgcctcattctcgagcagcaagacgacgccgtcgctggggagaaaacgccc
gcgggccacactatctcggcgaagaagggcacctatattctgaatccgggctctgacctc
cccaacacgctcggcacttttcagaaacctctctccaccctcgacgccacatggtccagc
gttgtctcgcgcacccccagcgaggccgagtttgaggctgcgctccgcgattcagacgtg
ctgctctatttcggtcatggtagcggtgcacagtacatccgcagcaagaccattcgccgc
cttgacaagtgccgcgccgcggcgttgctcatgggctgcagctccgccagtcttacggag
gccggcgagtttgaggtccacggccccgtgtggaactacatgatggcggggtgtcccgct
gttgtcggcacgctgtgggacgtgacggatcgggacattgaccgtttcgctggacggctc
tttgaggagtggggcctcatggtcaggggatcgttcccggttgacaagtggtcggccggg
ccagcgaacctagacgtcgtcgcgacaaggtctgttgtggaagctgtcgtgaaagcgagg
gatgcggtgcgatttcggtacctcacggccggggctgtctgcgtgtatggaattcccgtc
tatgtacgaccagacacgcggtga

DBGET integrated database retrieval system