KEGG   Verticillium dahliae: VDAG_06252Help
Entry
VDAG_06252        CDS       T03450                                 

Definition
(RefSeq) exoglucanase-6A
  KO
K19668  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
vda  Verticillium dahliae
Pathway
vda00500  Starch and sucrose metabolism
vda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VDAG_06252
Enzymes [BR:vda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     VDAG_06252
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_6
Motif
Other DBs
NCBI-GeneID: 20707715
NCBI-ProteinID: XP_009657561
UniProt: G2X8W1
Position
8
AA seq 395 aa AA seqDB search
MSTKSFLVAAALTTVALAVPHRNKCRDVATYEGNPLADVQLYPDPYYVNEIETLAIPQIE
DEELVAAAKAVTKISTFQWLTSDKISKIDLLNSTLHEIRAANDAGATPPYAATIVVYNFP
DRDCSAKASAGELILAEDGLNRYKTEYIDPIAALIKKFSDIRTVIVYEPDGLANLVTNMA
VEKCANAASAYREATEYGLAALNFANVAIYIDAGHAGWLGWDGNLQPTAELYAELYKNAG
SPKAVRGVVTNVSNFNGYNLTTPPAYTEPNAQWDESKFHAALAPHLETAGYPAHFIVDQG
RSGVQPGLRSAWSHWCNINGTGFGPRPTTEIADDITDAIVWVKPGGESDGTSDETAVRFD
ENCHSPSAFQPAPEAGGWFQAYFEMLLKNANPPLA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtctacgaagagcttcctagtcgccgcggccttgacgacggtcgcgctggccgttccc
cacaggaataagtgccgcgacgtcgccacctacgaaggcaacccgcttgccgatgtccag
ctgtatcctgatccgtactatgtcaacgagattgagactctcgccatcccgcaaatcgag
gacgaggagcttgtggcagccgccaaggcggttaccaagatctcgaccttccagtggctg
accagtgacaaaatatccaagatcgatctcctgaacagcacgcttcatgagattcgcgcg
gccaacgacgctggcgcaacccctccctatgccgccactattgttgtgtacaacttcccc
gacagggactgctcggccaaagcgtcggccggtgagctaatcctcgccgaggacggtctc
aaccgttacaagacggaatacattgatcccatcgcggccctcattaagaagttctccgat
atccgtactgtcatcgtttatgagcccgatggtctcgccaaccttgtcaccaacatggct
gtcgagaagtgcgcaaatgccgcttccgcgtaccgtgaggctaccgagtacggcctcgcc
gcactcaacttcgccaatgtcgccatctacattgacgctggccacgccggctggctaggc
tgggacggcaacctccagcctacggccgagctctacgccgagctttacaagaacgctggc
tcccccaaggccgtccgtggcgtcgtcaccaacgtctccaacttcaacggctacaacctc
acgacgccccccgcctacacggagccgaatgcgcagtgggacgagtccaagttccacgcc
gccctcgctccccacctcgagacagccggctacccggcacacttcatcgtcgaccagggg
cgctccggggtccagccaggcttgcgctccgcctggtcccactggtgcaacatcaacggc
acgggcttcggtccccggccgacgaccgagattgccgatgatatcaccgacgccatcgtc
tgggtcaagcccggcggtgagagcgacggcaccagcgatgagacggccgttcgctttgat
gagaactgccacagcccctcggccttccagcctgcccccgaagccggcggttggttccag
gcgtactttgagatgcttttgaagaacgccaacccccctctggcgtga

DBGET integrated database retrieval system