KEGG   Verticillium dahliae: VDAG_07355Help
Entry
VDAG_07355        CDS       T03450                                 

Definition
(RefSeq) biotin-protein ligase ligase
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
vda  Verticillium dahliae
Pathway
vda00780  Biotin metabolism
vda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vda00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    VDAG_07355
Enzymes [BR:vda01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     VDAG_07355
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     VDAG_07355
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     VDAG_07355
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     VDAG_07355
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_N BPL_LplA_LipB ThuA
Motif
Other DBs
NCBI-GeneID: 20708818
NCBI-ProteinID: XP_009654555
UniProt: G2XAX6
Position
5
AA seq 676 aa AA seqDB search
MSSRKLNVLVYTGTGTTAECVRHALMTLRRLLHPNYAVTPLTESALLKEPWAQTCALLVL
PGGGDLGYCRVLDGAGNRRITDFVRRGGRFLGFCAGGYFGSSRCEFEVGSSEKGMEVVGR
RELGFFPGTCRGGAFAGFRYHSEDGAQAVEISVEEGAFTENMGAPKRTKSYYNGGGVFVD
AAKLKDKGVEVLASYTGDIDVDGGDGQAAVVYCKVGDGGVVLTGPHPEFAAANLHRIPSN
PRYDQLIENLTQDDLPRSAFIKACLRKLGLEVNDEDADIPSLTAMHLTSVNHKEVEELIH
ALGDVVTLEDNEEYIRDEADTFHIDRDGKWSMKALAEALPNPDDPAKGKLSADGRYIDYS
DVIKEIVPYERAWPSDEITPAFQHSFYYGCLKAYQQMEEHASEWGNTLMYADATTSTNTI
MDKNPKLLSKLPTGFTLTAATQVAARGRGSNVWVCPAGTLVFSTVINHPAHLLGSRPIVF
LQYLTAVAIVEAIKSYDLGYDDVPVKLKWPNDIYARDPKSSASNPSYVKIGGILSTCSYT
GGAYTLVLGIGINATNARPTTSLNALLPSNLAPFRLEKLLARILTRLESLHSHWIRNGFD
SNLENRYYKHWLHSGQLVTLEEEGVRAKVVGITKDWGMLKAVEVDGVTGRETGRTWALQS
DENSFDFWRGLVRRKV
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcccgcaagctcaatgtgcttgtgtacacaggtaccggcaccacggccgagtgt
gtgcgtcatgcgctcatgacactgcgccgcctgctgcacccgaactacgccgtcacgccc
ctgaccgagtctgctctcctcaaggagccttgggctcagacctgcgccctcctcgtgctc
cctggcggaggcgatctcggctactgtcgcgtgctcgacggcgcgggaaatcgccgcatc
actgactttgtgcgccgaggcggacgtttcctgggcttctgcgccgggggctattttggc
tcttcgcgatgcgagttcgaggtcggcagcagcgagaaggggatggaggtcgtagggagg
cgagaactcgggttcttccccggaacgtgtcgaggcggtgcctttgcggggtttcggtac
cactccgaagacggggcacaggcggtcgagatctccgtcgaggaaggggcattcaccgaa
aacatgggtgcgccgaagaggacaaagtcgtattacaatggtgggggtgtctttgttgat
gctgccaagctgaaggacaagggggtagaggtgttggcgagctacaccggtgatattgac
gtggatggcggcgacggtcaggcggctgttgtgtattgcaaggttggcgatggcggcgtt
gtcctcacgggaccgcatcccgagtttgctgccgccaacctccatcgcatccccagtaac
cctcgatacgatcagctcatcgagaatctcacgcaggacgacctgccacgatcggctttc
atcaaggcatgcctccggaagcttggactcgaagtcaatgatgaagatgccgatatcccg
tccctcacagccatgcacctaacctctgtcaaccacaaggaggtcgaggagctgatccac
gctctcggtgatgttgtcacgcttgaagacaacgaagagtatatccgcgacgaggccgac
acattccatatcgatcgggatggcaagtggtcgatgaaagcccttgcagaggcccttccc
aaccccgacgatcccgcgaagggaaaactctccgccgatggacgatacatcgactatagc
gacgtcatcaaggagatcgtgccatatgagcgcgcctggccctcagacgagattacccct
gcgttccagcatagcttctactacgggtgcctcaaggcctaccagcagatggaggaacat
gcgtctgagtggggcaacactctaatgtacgcagatgctacgacgagcaccaacaccatc
atggacaagaacccgaaacttttgtcaaagctacccactggcttcaccctgactgccgcg
acacaagttgcagcgcgcggccgtggttccaatgtttgggtttgtcctgccggcaccctc
gtattctcgacagtgatcaatcacccggcgcacctcctcgggtcccgaccaatcgtgttt
ctccagtaccttactgctgttgccatagtcgaggccatcaaatcgtatgacttgggttac
gacgatgtacctgtcaagctcaaatggcccaacgacatatacgcgcgcgatcctaaatcc
tcagcctcgaatccttcctatgtcaagattggcggaatcttatctacatgctcctacacc
ggtggtgcgtacactctcgtgctaggcatcggcatcaatgcgacgaatgctcggcccact
acatctctcaatgctcttctcccatcgaaccttgcccctttccggctcgagaagctcctc
gcgcggattctcactcggctggaatcgttgcactctcattggatccgcaacggatttgac
tccaacctggaaaaccgctactataagcactggctacactcggggcaactggtgacgctc
gaggaagagggtgtccgggccaaagtggttggcatcacgaaggattggggcatgttgaaa
gccgtcgaggttgatggggttacgggacgggaaaccgggcggacgtgggccttgcaaagc
gacgagaacagctttgacttctggagggggcttgtaaggcgaaaggtctag

DBGET integrated database retrieval system