KEGG   Verticillium dahliae: VDAG_07511Help
Entry
VDAG_07511        CDS       T03450                                 

Definition
(RefSeq) succinyl-CoA ligase beta-chain
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
vda  Verticillium dahliae
Pathway
vda00020  Citrate cycle (TCA cycle)
vda00640  Propanoate metabolism
vda01100  Metabolic pathways
vda01110  Biosynthesis of secondary metabolites
vda01130  Biosynthesis of antibiotics
vda01200  Carbon metabolism
Module
vda_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vda_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VDAG_07511
   00640 Propanoate metabolism
    VDAG_07511
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vda04147]
    VDAG_07511
Enzymes [BR:vda01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     VDAG_07511
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     VDAG_07511
Exosome [BR:vda04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VDAG_07511
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A OKR_DC_1_N
Motif
Other DBs
NCBI-GeneID: 20708974
NCBI-ProteinID: XP_009654711
UniProt: G2XBH9
Position
5
AA seq 448 aa AA seqDB search
MFKFGRNRALASAFKPAELATSPSARLPSFAQQQRRNLSIHEYLSADLLRQYGIDVPKGS
VAKTAAEAKAIAKEIGGEDMVIKAQVLAGGRGKGTFDNGLKGGVRVIYSPHEAEMFADQM
IGHKLVTKQTGAGGRLCNAVYICERKFARREFYLAILMDRASQTPVIVSSSQGGMDIEAV
AKDSPEAINTTYIDINKGVTDEIARDIAVKLGFSEQCVEDAKDTIQKLYKIFTEKDSTQI
EINPLSETSDHKVMCMDAKFGFDDNADYRQKEVFEWRDTTQEDADEVRAAKSGLNFIKLD
GDIGCLVNGAGLAMATMDIIKLNGGAPANFLDVGGGATPQAIKEAFELITSDAKVSAIFV
NIFGGIVRCDHIATGLINTVQALDLKIPIIARLQGTNMEAAQKIIADSGMKIFAIDELQT
AAEKAVQLSKVVKLARESDVGVEFTLGI
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagttcggtcgcaaccgggctctggcttcggccttcaagcctgccgagctcgcc
acctctccctccgccagactccccagcttcgctcagcagcaaaggagaaacctgagcatc
cacgagtacctttctgccgaccttctgcgccagtatggcatcgacgtccccaagggttcc
gtcgcgaagaccgccgccgaggccaaggccatcgcgaaggagattggtggtgaggacatg
gtcatcaaggcccaggttctcgccggtggccgtggcaagggcaccttcgacaacggcctg
aagggcggcgtccgtgtcatctactctccccacgaggctgagatgttcgccgaccagatg
attggccacaagctcgtcaccaagcagaccggcgctggcggccgtctctgcaacgccgtc
tacatctgcgagcgcaagttcgcccgtcgcgagttctacctcgccatcctgatggaccgt
gcctcccagactcccgtcatcgtgtcctcgtcgcagggtggcatggacattgaggccgtc
gccaaggacagccccgaggccatcaacaccacctacattgacatcaacaagggtgtcacc
gacgagatcgcccgcgacattgctgtcaagcttggcttcagcgagcagtgcgtcgaggat
gccaaggacaccatccagaagctgtacaagatcttcaccgagaaggactctacccagatt
gagatcaaccctctgtccgagacctccgaccacaaggtcatgtgcatggatgccaagttc
ggcttcgacgacaacgccgactaccgccagaaggaggtctttgagtggcgcgataccacc
caggaggacgccgacgaggtccgcgccgccaagtccggcctgaacttcatcaagcttgac
ggtgacattggctgcctcgtcaacggtgccggtcttgccatggccaccatggacatcatc
aagctgaacggcggtgcccctgccaacttcctcgacgtcggtggcggtgccaccccccag
gccatcaaggaggcctttgagctcatcaccagcgacgccaaggtctctgccatcttcgtc
aacatctttggtggtatcgtccgctgcgaccatatcgccaccggtctgatcaacaccgtc
caggccctcgacctcaagatccccattattgctcgtctccagggcaccaacatggaggct
gcccagaagatcattgccgactctggcatgaagatcttcgccatcgatgagctccagact
gctgccgagaaggctgtccagctgtccaaggttgtcaagctggcccgtgagagtgacgtt
ggcgtcgagttcaccctgggtatctaa

DBGET integrated database retrieval system