KEGG   Verticillium dahliae: VDAG_07593Help
Entry
VDAG_07593        CDS       T03450                                 

Definition
(RefSeq) myrosinase
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
vda  Verticillium dahliae
Pathway
vda00460  Cyanoamino acid metabolism
vda00500  Starch and sucrose metabolism
vda01100  Metabolic pathways
vda01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VDAG_07593
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    VDAG_07593
Enzymes [BR:vda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     VDAG_07593
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 20709056
NCBI-ProteinID: XP_009654793
UniProt: G2XC15
Position
5
AA seq 472 aa AA seqDB search
MASQFEFDPALAGSLPADFVWGWATAAAQVEGAWDKDGKGVSIWDTFAHTPGKVKDGSTG
DDAVRSYDLYATDVALLKKYRARGYRFSLSWARLIPLGGADDDVNEAGVAYYDRLIDGLL
AQGITPYVTLFHWDTPQALEDRYGGMLDKARFTRDFVRYARLCFERFGDRVRDWITFNEP
GVYTLAGYAAGVHAPARSSFRERNAEGDSSTEPFIVAHTELVAHAHAADVYKREFQPTQK
GTVMITLHGNWSEPWDAGDARDVEAAERAREFEIAWFADPLYKTGDYPASMRAQLGDRLP
RFTEEESRLVLGSSEVYGMNSYSAFYVKHRDGPADINDHKGNIEQADENSEGTPRGPASD
TYWLRTTPWGWGKLLRWIWARYGVPIYITENGTTAQGEHDWKPTGPDDVLEDPFRIDFFR
QYLTEVAKASQEGYSDRFGATWIDFDSPEKTRYAKRSAYFLGDYFDHLIKSE
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgcaattcgagtttgaccccgccctcgccggctcgctgccggccgactttgtc
tggggctgggcgacggcggcggcgcaggtcgagggcgcgtgggacaaggacggcaagggc
gtctcgatctgggacacgttcgcgcacacgccgggcaaggtcaaggacggcagcacgggc
gacgacgcggtgcggtcgtacgacctgtacgcgacggacgtggcgctgctgaaaaagtac
cgggcgcgggggtaccggttctcgctgtcgtgggcgcggctcatcccgctcgggggcgcc
gacgacgacgtcaacgaggcgggcgtggcgtactacgaccggctcatcgacggcctgctg
gcgcagggcatcacgccgtacgtgacgctgttccactgggacacgccgcaggcgctcgag
gaccggtacggcggcatgctcgacaaggcgcggttcacgcgcgactttgtgcggtacgcg
aggctgtgctttgagcgcttcggcgaccgcgtcagggactggatcaccttcaacgagccc
ggcgtgtacacgcttgccgggtacgcggcgggcgtgcacgcgccggcgcggtcgagcttc
cgcgagcgcaacgccgagggcgactcgagcacggagccgttcatcgtggcgcacacggag
ctcgtggcgcacgcgcacgcggccgacgtgtacaagcgcgagttccagccgacgcagaag
ggcaccgtcatgatcacgctgcacggcaactggtcggagccgtgggacgccggcgacgcg
cgcgacgtcgaggcggcggagcgggcgcgcgagtttgagattgcctggttcgccgacccg
ctgtacaagacgggcgactacccggcgtcgatgcgcgcgcagctcggcgaccggctgccg
cggttcaccgaggaggagagcaggctcgtgctcggcagctccgaggtgtacggcatgaac
tcgtactcggccttttacgtcaagcaccgcgacgggccggccgacatcaacgaccacaag
ggcaacattgagcaggccgacgagaacagcgagggcacgccgcgcgggccggcgagtgac
acgtactggctgcgcacgacgccgtggggctggggcaagctgctgcggtggatctgggcg
cggtacggcgtgcccatctacatcacggagaacggcacgacggcgcagggcgagcacgac
tggaagcccacgggccccgacgacgtgctcgaggatcccttccgcatcgactttttccgc
cagtacctgaccgaggtggccaaggcgtcgcaggagggctactcggaccgcttcggcgcc
acgtggatcgatttcgacagcccggagaagacgcggtatgcgaagcgctcggcgtacttt
ctgggcgactactttgaccacctcatcaagagcgagtag

DBGET integrated database retrieval system