KEGG   Verticillium dahliae: VDAG_09443Help
Entry
VDAG_09443        CDS       T03450                                 

Definition
(RefSeq) pyruvate decarboxylase
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
vda  Verticillium dahliae
Pathway
vda00010  Glycolysis / Gluconeogenesis
vda01100  Metabolic pathways
vda01110  Biosynthesis of secondary metabolites
vda01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VDAG_09443
Enzymes [BR:vda01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     VDAG_09443
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C E1_dh DXP_synthase_N E1-N
Motif
Other DBs
NCBI-GeneID: 20710906
NCBI-ProteinID: XP_009656699
UniProt: G2XH11
Position
7
AA seq 574 aa AA seqDB search
MASIREQGLEEPIEVATYLYKRLYEIGVRSLHGLPGDYNLVALDYLPKAGVKWVGSVNEL
NAGYAADGYARVKGVSAIMTTFGVGELSAINALAGAYSEHIPVVHIVGCPSTVSQRNGML
LHHTLGNGDFNVFANMSSQISCNMAKLNNPAEIATQIDHALQQCYIQSRPVYIMLPTDMV
EKKIEGARLKTPIDLEEAPNDPEKEDYVVDVVLKYLHAAKKPVMLVDACAIRHRVLDETH
ALLEKSGIPVFVTPMGKSAINETHSNYGGVYAGEASRPEVKEKIESADLILSIGTLKSDF
NTAGFSYRTSQLNTIDFHSTHTVVRYSEYPGVKMRGVLRKVTEKLDLSKLSVIPSPDAPV
ALPTKEEDSSQTITQAWLWPRVGHFLRKNDIVVTETGTANFGIWDTAFPSGVTALSQVLW
GSIGWSVGACQGAALASKDAQTDRRTILFVGDGSFQLTAQEVTTMIRHQLRVTIFVICND
GYTIERFIHGMDAGYNDVVQWKYQDTVTVFGGTDKTAKKFQVRTKEELDKLFKDESFNNA
KEVQFVELYMEKKDAPRALVMTAEASAKTNAKDS
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggccagtattcgcgaacaagggctcgaggagcccattgaggtggctacctacttgtac
aagagactctacgagattggcgtccgctcacttcacggactgcccggcgactacaacctc
gtcgcactggactaccttcccaaggccggcgtaaaatgggtgggcagcgtcaatgagctc
aacgcggggtatgctgcagatggctatgcccgtgtcaagggcgtctcggccatcatgacc
acctttggcgtaggtgagctatcggccatcaacgccctcgccggcgcctattcggaacac
attcccgtcgttcacattgtcggctgcccctccaccgtgtcacagcgaaacggtatgcta
ttgcaccacactcttggcaatggcgatttcaatgtcttcgccaacatgagctcccagatc
tcctgcaacatggccaagctcaacaaccctgccgagattgcaacccagattgatcatgct
cttcagcagtgctacattcagagcaggcccgtctacatcatgttgcctaccgacatggtg
gaaaagaagatcgagggcgcccgactcaagacacccattgatcttgaggaggcacccaac
gacccagaaaaggaggactacgtcgtcgatgtcgtcttgaagtaccttcacgctgccaag
aagccggtcatgctcgttgacgcctgtgctattcgtcacagagtgctagacgagacccac
gcgttgttggagaagtctggtatccccgtttttgtgacgcccatgggaaagagtgccatt
aacgagacacactccaactacggtggtgtttatgccggcgaggcctcgcgacccgaagtc
aaggagaagatagagtcggcggacttgatcttgtccatcggtactctcaagagcgacttc
aacacagccggcttctcgtaccggacctctcagctcaacaccattgacttccacagcaca
cacaccgtggtacgatactcggaatatcctggcgtcaagatgcggggcgtgctccgtaag
gtgacggagaagcttgacctcagcaaactgtcggtcatcccgtcgccagatgcccctgtc
gccttgccgacaaaggaggaggactcgtcacagacaattactcaggcgtggctgtggccc
agagtaggccacttcctacgcaagaatgacattgtagtgacggagactggcactgccaat
ttcggcatctgggacacagccttcccaagtggtgtcacggctctgagccaggttctctgg
ggcagcatcggatggtctgtcggcgcttgccagggcgctgctctggcttccaaggacgcc
cagactgacaggcggactatcctgttcgtgggcgatggatcattccagctcaccgcccaa
gaggtcaccaccatgatccgccatcaactcagagtgacaatctttgtcatttgcaacgac
ggctacacgatcgagcgtttcatccacggcatggacgccgggtacaatgatgttgttcag
tggaagtaccaggacacagtcacggtgttcggcggcaccgacaagacggccaagaaattc
caggttcgcaccaaggaggagctcgacaagctcttcaaggacgagagcttcaacaatgcc
aaggaggtgcagtttgtcgagctctacatggagaagaaggatgcgccgagggcactcgtc
atgacggcagaggccagcgccaagacgaatgcgaaggacagctag

DBGET integrated database retrieval system