KEGG   Verticillium dahliae: VDAG_09457Help
Entry
VDAG_09457        CDS       T03450                                 

Definition
(RefSeq) MSN5 protein
  KO
K14289  exportin-5
Organism
vda  Verticillium dahliae
Pathway
vda03013  RNA transport
Brite
KEGG Orthology (KO) [BR:vda00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    VDAG_09457
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vda03016]
    VDAG_09457
   03036 Chromosome and associated proteins [BR:vda03036]
    VDAG_09457
Transfer RNA biogenesis [BR:vda03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    VDAG_09457
Chromosome and associated proteins [BR:vda03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     VDAG_09457
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IBN_N Xpo1
Motif
Other DBs
NCBI-GeneID: 20710920
NCBI-ProteinID: XP_009656713
UniProt: G2XH25
Position
7
AA seq 1272 aa AA seqDB search
MASAHSNGAAGIGSSNGGEVDILSQIHQALEVVHAPYSANGARREAQEFLENVKAVDEAP
FHGYTLASNKSQPAVVRHYALSLLDNAIKHKWADYTTEQASTLRGWMLELCQGISQADPL
YIRNKTAQLWVEVAKRSWGTEWMDMDELLVQLWQVPDSAVHKELVMTVLETLGYETFFGD
DVVVAMRQGVLCKGWTEITTPTAVLAEAIKNRNPAPEVRYGDEGWLVRLVTLLEQCLNGD
INGNSEVRSCAVKALSVLSTLMPCTIPKGTAASKVVPVASRALAASQVSVQKGALEVLHA
LYSRDDFYDEEFAELVAPMYEQASVGLLKELFNWSVVDAEDIDDDKYQFAKKFSEMLSLL
GNYLDRKFSVVPTGSDIDGFLNLLVVVAQSQSLIVSIPVLVTWTRLLNNRLIGQSSANSQ
LIGPLLELCGSRLIRYENLPEDTQDATYLFLMEDTDTMPERHAFLGNYRRYSMQVIEAIV
QLKPSDAISHILGQTEQVLHHLYDGQPSLNVAAYAKHSMPVLRADAHLTVIDAANKGYMK
WRANPIQRGNPDYDQQRSSLEDGLESWCHRLLDMNFEDPMVRKRVLQILVLMSTSALDKR
PQFMLKVLEHILMTWPAPQPEHRAFNEAIKDFQSESMFELQRLASKVPDHLLAVYDQVET
RVRDMVTSGTLDEKRQIAYQTFLFIIVHRASNIDPQVQMQRLEGFIEPIKAQWQNPELKQ
ALSSYSGFCELMALDKAKAYLRNHGAHTVSDWGACELDAEGLALQAELEDRQKMLPLRPT
KSFLSYSVEKLEKSSQPFQASYRLWNNEAFQAILPDLLQFLSHAHASHNPDNWPEFPNEM
GTVVKRVLSDRFWQAGISEGSKDEFYARVTDRKGTLEGLASTIRGSVRFVRETCYAIIYC
MSRLETYFYGFGELPSPLAEALFQNAVHLSAHQQINLLNLTRYLVDDCPLEQREHFLPPL
LANCFRQMDAKISSEWKRLEDQQKIDVGSDDLTEEMKSESILRQVTHTAVIMVADFLDPT
KRNPAPLRPQDPPKRYPTLRKFCLMHSSIVEPLLLFSTHAIRMRDGRCCNIILRVFRSIV
PDFQSSDVTAAGGDGNTQQDGGADPWLDTTAIDHERATQIREYISTQVLEACVTSFHEPY
FVDLQKDLASLIAAIVVHYMTLTDSPKNFLLSIPGVKFKDFEKLGEFAPKPSSGSRQQRA
LVLHLLKDVKGVSMAEMHKLPKSGLPAVQKKPARSKMAQEFMTPADEAGSKGQPSTGVAD
DSLVGLANLFDA
NT seq 3819 nt NT seq  +upstreamnt  +downstreamnt
atggcctcggcgcattccaatggcgctgccggcatcggctcgtcaaacggcggggaggtc
gatatcctctcccagattcaccaggccctcgaggtcgtacacgccccctactccgccaac
ggagctcggagggaggcgcaagagttcctcgaaaacgtcaaggccgtcgacgaagccccc
tttcacggctacaccctggcctcgaacaagtcgcagcccgccgtcgtccgacactatgcg
ctctcgcttctcgacaatgccatcaagcacaagtgggccgactacaccaccgaacaggcc
tcgaccctcagggggtggatgctggagctgtgccagggcatctcgcaagccgatccgttg
tacatcagaaacaagacggcccagctctgggtggaggtggcgaaaaggtcgtggggcacc
gagtggatggacatggacgagctgctggttcagctttggcaggtgcccgactcggccgta
cacaaggagctcgtcatgacggtcctcgagacgctgggctacgagaccttctttggcgat
gacgtcgtggtggctatgaggcagggggtcctgtgcaaaggttggacagaaatcaccacg
cccactgctgtgctggccgaggcgatcaagaaccgcaacccagcccccgaagtgcggtac
ggtgacgagggctggctggtgcggttggtgactctgctcgagcaatgtctcaacggcgac
atcaacggcaacagcgaagtgcgttcctgcgccgtgaaggcgctctccgtcctcagcacg
ttaatgccgtgcaccatccccaagggcaccgcagcctcgaaagtcgtccccgtcgcctcc
agagcgcttgctgcttcccaggtgtctgtccaaaagggagctctggaggttttgcatgcc
ctttattcacgcgatgacttttacgacgaggagttcgcagagctggtggcgcccatgtac
gagcaggcgtcggtcggactgctcaaggagctctttaactggtcagtggtcgatgccgaa
gatattgacgacgacaaataccagtttgctaagaaattttccgagatgctgtccttactt
ggaaattatcttgatcgaaaattctccgtcgttcccacggggtcagatatcgatggtttc
ctgaatcttctcgttgttgtagcgcaaagccagagcctcattgtgtccatccctgtgctc
gtaacgtggacccgtctcctcaacaacaggttaatcgggcaaagttccgccaactcacag
ctcattgggcctctgcttgagctgtgcggctcgaggctcatcagatacgagaacctgcct
gaagacacgcaagatgccacctatctgttcctcatggaagacacagacaccatgcctgag
aggcatgctttcctaggcaactaccgtcgctacagcatgcaagtcatagaggcgattgta
cagctgaagccgtccgacgccatctcgcacatcctgggccaaaccgagcaggtgctgcac
catctgtacgatggacagccgagcctgaatgtcgccgcatacgcgaagcattccatgcct
gttctacgcgccgatgcccacttgaccgtaatcgatgccgccaacaagggctacatgaag
tggagggccaacccaatccaacgcggcaatcccgattatgatcaacaacgatcgagcctc
gaggacggcctcgaatcttggtgtcacaggcttctggatatgaactttgaagacccaatg
gttcgcaagagggtactgcaaatcctggtcctcatgtcaacatcagcactcgataagaga
cctcagttcatgctgaaggtcctcgagcacatactaatgacgtggccggcgccccagccg
gaacaccgtgccttcaacgaggccatcaaggactttcagtctgaaagtatgttcgaactg
cagaggctagcatccaaggtccccgatcatctgcttgctgtttatgatcaagttgagacg
cgggtccgtgacatggtcacttcggggacgctcgacgagaagcgacagattgcatatcaa
acatttctgttcatcatcgttcacagggcgagcaacattgatccccaggtccagatgcag
cgattggaaggtttcatcgagccaatcaaggctcagtggcagaatcccgagcttaagcag
gctctttcgtcatactctggcttctgtgagctgatggcgctagataaagcgaaggcctat
ctcaggaatcacggagctcatactgttagtgactggggcgcgtgcgagctggatgctgag
ggccttgctctgcaggcggagctcgaagacaggcaaaagatgctgccccttcgaccgacc
aaatctttcctgtcttactctgtcgaaaagctggagaagtcttcccagcccttccaggca
tcatacaggctctggaataacgaagccttccaggccatcttgcctgatcttctgcaattc
ctcagccatgcccatgcttcgcacaaccccgacaactggcccgaatttcccaatgagatg
ggcactgtcgtcaagagagtgctcagcgatcgcttttggcaggcaggcatctcggaaggc
agcaaagacgagttctacgcacgcgtaacagataggaaagggacgcttgaaggtcttgca
tcgaccatcagaggctcggtgcggttcgtgcgagagacatgctatgcgattatttactgc
atgagccggctcgagacgtacttttacggctttggcgaactgccgagccccctcgccgag
gcgttgttccagaacgcagtccacctgtctgcccatcaacagatcaatctgctgaacctg
acgagatacctggtggatgattgtccgctggaacagcgcgagcacttcctgccgccgctc
ctggcgaattgcttccgacagatggacgcgaagatcagttctgaatggaagaggcttgag
gaccaacaaaagattgacgtcggaagcgatgacctgaccgaggagatgaagtcggagagc
atcctgcgtcaggtcactcacacggcagtcatcatggtcgccgatttccttgaccctacg
aagcgaaaccccgcgccgctgcggccacaggaccctcccaaacgatacccgacgcttaga
aagttctgtctcatgcactcaagcattgtcgagcctcttcttttgttcagtacgcacgct
atccgaatgagagatgggaggtgctgtaacatcattctgcgtgtcttccgatcgattgtg
cccgacttccagtcgtccgatgtaacagctgcaggtggcgatggcaacacacaacaggac
ggcggcgcagatccctggctcgacacgacggccatcgaccacgagagggccacgcagata
cgcgaatacatctcaacacaggtgctcgaggcgtgcgtgacatcgttccacgagccgtac
tttgtcgacctgcagaaggatctcgcgtcgctcatcgcggcgatcgtggtccactacatg
acgctgacggactcgccgaagaatttcctcctcagcatcccaggcgtcaagttcaaagac
tttgagaagctcggggagtttgcgccgaagcccagctccgggtcgcgccagcagcgggcg
ctcgtgctacaccttttgaaggacgtcaagggcgtgagcatggccgagatgcacaagctg
cccaagagcgggctgccggctgtgcagaagaagccggcgcgcagcaagatggcgcaggag
tttatgacgcccgcggacgaggcggggtccaaggggcagccatcgacgggcgtcgcggat
gacagcctcgttggactcgccaacttgttcgacgcgtag

DBGET integrated database retrieval system