KEGG   Verticillium dahliae: VDAG_09749
Entry
VDAG_09749        CDS       T03450                                 

Definition
(RefSeq) Delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
vda  Verticillium dahliae
Pathway
vda00100  Steroid biosynthesis
vda01100  Metabolic pathways
vda01110  Biosynthesis of secondary metabolites
Module
vda_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:vda00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    VDAG_09749
Enzymes [BR:vda01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     VDAG_09749
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 20711212
NCBI-ProteinID: XP_009652903
UniProt: G2XHJ5
Position
3
AA seq 491 aa
MAGLKKEVASSAPPHGYHFGGPWGTAGVSTILPIVVYALAFACNDVSGCPAPSLLDPKNI
DLAQLKREVGWPEEGIWGLGSFNATLAVVGYFFFNALLYRFLPAQEVDGVVLASGGKLKY
RFNSFASSMFIVAILAAGTALEGADWALWVYISDNYIQILTANMILAFVIATYVYVRSFS
VKPGNKENRELAEGGHSGNLIYDWFIGRELNPRVTIPIIGEVDIKHWMEVRPGLLGWAIL
NFAWIAKQYRTFGFVSNSIIFISAIQFLYTVDCWWNEPAILTTIDITTDGFGFMLSFGDI
AWLPFIYSMQTRYLSMYPVSLNAFQVTTIGATICLAYYIFRASNNQKNKFRTNPNDPSVA
HLKYIETKAGTRLLISGWWGVARHINYLGDWLQAWPYSLPTGMSGYQILTAGSGLVEQGV
EGAFKTLDGREVVQGAARGWGIPVTYFYVLYFAILLIHRDRRDDDKCARKYGDDWEKYKK
IVRWKILPGVY
NT seq 1476 nt   +upstreamnt  +downstreamnt
atggctggactgaaaaaggaggtcgcatctagcgccccgcctcatggctaccacttcggc
ggaccttggggtaccgccggcgtttctaccatcctccctattgtcgtgtacgccctcgca
ttcgcctgcaacgacgtctccggctgccctgccccgtctctcctcgacccgaagaatatc
gacttggcgcagcttaagcgtgaggttggatggccagaagaaggcatttggggcctaggt
agtttcaacgctactctagccgttgttgggtacttcttcttcaacgccctactgtaccga
ttccttcctgctcaggaagttgatggtgtcgtactggcctctggcggcaagttgaagtat
aggttcaactcttttgcatcgagcatgttcatcgttgcgatccttgccgccgggactgcc
cttgagggcgccgactgggctctctgggtctacatctccgacaactatatacagattctc
acagccaatatgattttggcgtttgttattgccacctatgtctacgttcgcagcttcagc
gttaagcctgggaacaaggagaaccgcgagcttgccgagggtggccactcaggcaacctc
atttacgactggttcattggccgcgagctcaacccgcgcgtcacgatcccaatcattggc
gaggttgacatcaagcactggatggaggtccgccctggccttctcggctgggccatcctc
aattttgcctggatcgccaagcagtaccgcacatttggcttcgtctccaacagcatcatc
ttcatttcggccattcagttcctctacacggtagattgctggtggaacgagcctgccatt
ctgacgaccatcgacattaccaccgatgggttcggcttcatgctatcctttggcgacatt
gcatggcttccattcatctactctatgcagacgcggtacctgtcgatgtaccccgtatcc
ctgaacgcctttcaggtgactaccattggagctaccatctgcctggcctattacatcttc
cgtgcctccaacaaccagaagaacaagttccgcaccaaccccaacgaccccagcgttgcc
catctcaagtacattgagaccaaggctggcactcgccttctcatctctggctggtggggt
gtcgcccgccacatcaactaccttggcgattggctccaggcgtggccatactctcttccc
acaggcatgtcgggttaccagattctgacagcgggttccggcctagttgagcagggcgta
gagggtgccttcaagaccctcgacggtcgtgaggtggtgcagggtgctgctcgcggctgg
ggcattcctgttacgtacttttacgtgctttacttcgcgatcctgctcatccaccgtgac
cgccgcgacgatgacaagtgcgcacgtaagtacggtgatgactgggagaagtacaagaag
attgtcaggtggaagattcttcctggcgtgtattag

DBGET integrated database retrieval system