KEGG   Vibrio diabolicus: AL552_11200Help
Entry
AL552_11200       CDS       T05332                                 

Definition
(GenBank) two-component system sensor histidine kinase PhoR
  KO
K07636  two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC:2.7.13.3]
Organism
vdb  Vibrio diabolicus
Pathway
vdb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vdb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AL552_11200
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vdb01001]
    AL552_11200
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:vdb02022]
    AL552_11200
Enzymes [BR:vdb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     AL552_11200
Protein kinases [BR:vdb01001]
 Histidine kinases
  OmpR family
   AL552_11200
Two-component system [BR:vdb02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   AL552_11200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoR HATPase_c HisKA PAS PAS_8 HATPase_c_2 HATPase_c_3 PAS_4 PAS_9 HATPase_c_5
Motif
Other DBs
NCBI-ProteinID: AVF94332
Position
1:472276..473574
Genome map
AA seq 432 aa AA seqDB search
MVERLTWKKLAWELAFFYTPWVIVGWIFGYMPWLLLAATALQLVWHLHNQVRLSSWLWDE
KRLTPPSGSGNWESLFNGLYRLQQRQRRKRKELTNLIRRFRNGAESLPDAVVVFRAEGNI
VWCNKLAQHLLGFHWPEDSGQPISNLIRTPDFIKYLNKKDFSEPLEMRSPLNVERMLELR
IVPYTEGEHLMVVRDVSQLKQLEGMRRNFFANVSHELRTPMTVLQGYLEMTEDPDMVVGP
MWSKAHGVMTEQLNRMNSLVNQLLTLSKIEAAPMHELEEVVNVPAMLEVLEKEAVSLSGD
NQHKLKFDVDASLRVLGDDDQLRSAISNLVYNAVKYTPPGANINVRWFQTSQGACLEVED
SGDGIEPQHLHRLTERFYRVDKARSRDTGGSGLGLAIVKHALSHHDSHLEIHSEVGVGSK
FSFVLPERLVVK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtggttgaaagattaacgtggaaaaagctggcctgggagctggcttttttttacacccca
tgggtgatagtaggttggatattcggttatatgccgtggttgcttttggcagctacggca
ttgcagcttgtgtggcatttgcataaccaagtacgtttatcttcttggttatgggatgaa
aagcgccttacgccaccgtctggtagcggtaactgggaatctttgttcaatggcttgtat
cgcttacagcagcgccaacgccgtaaacgcaaagagcttactaatctcattcgccgattc
agaaatggtgcggaatcgttacccgatgcggtagtggtattccgtgctgaaggcaatatt
gtttggtgtaacaaactggctcaacacttattgggtttccattggccggaagactctggt
caacctatctccaacctcattcgtacgcctgactttatcaagtacctcaacaagaaagac
ttttcagagccattggaaatgcgctcaccactcaatgtcgaacgcatgctagaactacgt
atagtaccgtataccgaaggtgaacatttgatggtggtgcgtgatgttagccagttaaaa
caacttgagggaatgcgccgtaatttctttgctaacgtttctcatgaactgcgtacacca
atgacggtgctacaaggttatttagagatgacagaagaccctgacatggttgtgggccca
atgtggagcaaagcgcatggcgtcatgacggagcagctcaaccgcatgaacagtttggtg
aaccaattactgacgctatctaaaattgaagcggcacctatgcatgagcttgaagaagtc
gtgaatgtacctgcgatgcttgaagtgttagaaaaagaggcggttagccttagtggagac
aaccaacataaattgaaatttgatgttgatgctagcctacgcgtactgggcgatgatgac
cagttacgcagtgctatctccaaccttgtttataatgctgtcaaatacacaccacctggt
gcaaacattaatgttcgttggttccagacatctcaaggcgcatgcttagaggtggaggat
agtggtgatggtatagaacctcagcacctccatcgacttactgagcgtttttatcgcgtc
gataaagcaagatcacgcgataccggagggagtgggttagggttggccattgtaaaacac
gcgctgagccaccatgactctcatttagaaattcacagtgaagtaggtgtgggcagtaag
ttttctttcgtattgcctgagcgtttggtggtgaaataa

DBGET integrated database retrieval system