KEGG   Vibrio diabolicus: AL552_13860Help
Entry
AL552_13860       CDS       T05332                                 

Gene name
bioF
Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
vdb  Vibrio diabolicus
Pathway
vdb00780  Biotin metabolism
vdb01100  Metabolic pathways
Module
vdb_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:vdb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AL552_13860 (bioF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vdb01007]
    AL552_13860 (bioF)
Enzymes [BR:vdb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     AL552_13860 (bioF)
Amino acid related enzymes [BR:vdb01007]
 Aminotransferase (transaminase)
  Class II
   AL552_13860 (bioF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AVF94792
Position
1:1023829..1024980
Genome map
AA seq 383 aa AA seqDB search
MPAFKPRIESALADRKAQGLNRSMNVVFSGNQSILEYEGRRYINFSSNDYLGLANDQALV
RAWQQGLSVYGSGSGASPMVTGFSAAHSNLEAALTEWLGYERAVLFGSGFSANQALLFTL
LEKSDVLIQDRLNHASLMEAGALSPAKMKRFKHNDIEHLKSLLNSEDNHLVVTEGVFSMD
GDCAPLADIADVTGNHDAWLAVDDAHGIGVLGESGGGSCELAAVKPEILIVTFGKAFGMS
GAAILCDHATGDFLTQFARHHVYSTAMPPAQAYALTHAVSMVQEQSWRREKLTELSEVYR
DSLNDVEGFVETQTSIKPFVIGESDLALRVAGACRQNGIWVTAIRPPTVPKGTSRLRITL
TANHTNEQVKTLSMALKQALGTQ
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgccagcgtttaaacctcgtatcgagtccgcccttgccgatcgtaaagcgcaggggttg
aatcgttcgatgaatgtggtgttttccggcaaccaatcgattttggaatacgaaggcaga
cgctacatcaacttctcaagtaatgattatttaggcttggccaatgaccaagcgctcgtt
cgtgcttggcagcaaggcttgagtgtatacggcagtggcagtggtgcatctccaatggtc
acaggttttagtgcagcgcacagcaatttagaagcggcactaaccgaatggctgggttac
gaaagggcagtcctgtttggctctggattcagcgctaaccaagctttgttattcaccttg
ctagaaaaatcagacgtactcattcaagaccgtttgaaccatgcctcgttgatggaagcg
ggggcgttgtcaccagctaagatgaagcgcttcaagcacaatgacatcgagcacctaaag
tcgctgctgaatagcgaagacaatcacttagtcgtgactgaaggggtgttcagcatggac
ggtgactgtgccccacttgctgatatcgctgacgtcaccggtaatcatgatgcatggctt
gctgtagacgacgctcatggtatcggtgttctaggggaatctggcggtggctcatgtgaa
ttagcggcggttaagcctgagatactgatcgttactttcggcaaagcgtttggtatgtct
ggcgcggctattttatgtgaccacgcaacgggggactttttaactcagtttgctcgtcac
catgtgtattccacggcgatgcctccggcacaagcctatgcgctcacgcatgctgtctcg
atggttcaagagcagtcttggcgacgtgaaaagctcacagagttaagtgaagtgtatcga
gatagcctcaacgacgttgagggctttgttgagactcaaacttcgattaagccgtttgtg
attggtgaatctgatttggctttgcgagtagcaggtgcttgtcgccaaaacggtatttgg
gttactgctattcgtcctccaacagttccgaaagggacgtctcgtcttcgaatcacactc
actgctaatcacactaacgaacaagttaaaacgctttcaatggcgttgaagcaagcatta
ggaacgcagtaa

DBGET integrated database retrieval system