KEGG   Vibrio diabolicus: AL552_14955Help
Entry
AL552_14955       CDS       T05332                                 

Gene name
maiA
Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
vdb  Vibrio diabolicus
Pathway
vdb00350  Tyrosine metabolism
vdb00643  Styrene degradation
vdb01100  Metabolic pathways
vdb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vdb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    AL552_14955 (maiA)
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    AL552_14955 (maiA)
Enzymes [BR:vdb01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     AL552_14955 (maiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: AVF94998
Position
1:1266219..1266887
Genome map
AA seq 222 aa AA seqDB search
MSDSMILYGYWRSSAAYRVRICLNLKELSYDSKSVHLVRNGGEQHSDEYHELNASELVPV
LVDGEIQLTQSLAIIQYLEEHYPDVTVIPEQAPLRYQALAMAQDIAMEIHPLNNLRVLQY
LEGELACEPERKVAWIHHWIHKGFTALEEKLQKHRKLNGDCKFSLTSSPSIVDICLVPQF
YNAQRFGVDTSLYPTINAVVQSCNQLPAFIDAMPENQPDANS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatagcatgattttatacggatactggcggtcatcggcggcgtatcgtgtgcgt
atttgtttgaatcttaaagagttatcgtatgattcaaaatcggtacacttggtgcgcaat
ggtggcgaacaacacagtgacgagtaccatgagttaaacgcttctgaactggttcctgtg
ctggtggatggtgagattcagttaacccagtcactggccatcatccaatacttagaagaa
cactatccggatgtcactgtgatccccgagcaagcgccacttcgataccaagcactagct
atggctcaggatattgcgatggagattcatcctctgaataacttaagagttctacagtat
ttagagggggagttagcttgtgagccagagcgcaaagtcgcttggattcatcactggatc
cacaaaggttttacagcattagaagagaaacttcagaagcatcgtaaactaaatggtgat
tgcaagtttagcctgacaagttcgccatctattgtcgatatttgtctggtaccacaattt
tataacgcacaacgctttggtgtagatacttctctttatccaaccattaacgctgttgtg
cagtcatgcaatcagctgcctgcttttattgatgcgatgccagagaatcagccagacgct
aatagttga

DBGET integrated database retrieval system