KEGG   Vulcanisaeta distributa: Vdis_0688Help
Entry
Vdis_0688         CDS       T01313                                 

Definition
(GenBank) ketol-acid reductoisomerase
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
vdi  Vulcanisaeta distributa
Pathway
vdi00290  Valine, leucine and isoleucine biosynthesis
vdi00770  Pantothenate and CoA biosynthesis
vdi01100  Metabolic pathways
vdi01110  Biosynthesis of secondary metabolites
vdi01130  Biosynthesis of antibiotics
vdi01210  2-Oxocarboxylic acid metabolism
vdi01230  Biosynthesis of amino acids
Module
vdi_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
vdi_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:vdi00001]
 Metabolism
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Vdis_0688
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Vdis_0688
Enzymes [BR:vdi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     Vdis_0688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IlvN IlvC AdoHcyase_NAD 2-Hacid_dh_C F420_oxidored NAD_binding_2 ApbA NusB
Motif
Other DBs
NCBI-ProteinID: ADN50083
UniProt: E1QNB3
Position
670328..671311
Genome map
AA seq 327 aa AA seqDB search
MARIYKDGDADLSVIRGKVVAVLGYGIQGRAWALNMRDSGVKVIVGVRPGKSFDLARQEG
FEVYPVGDAVRRADIIAVLLPDMVQPSVWGSEIAPGLRRGMTVVFAHGFNIRFGLIRPPS
DVDVVLIAPKAPGKAVRDEFVRGWGVPALVAVHQDFTGSALKTALAIAKANGFTRVGVIE
TTFAEETETDLIGEQNVLVGGLLQLLRYGFEVMVELGYQPEVAYFEAINEAKLIMDLIWE
RGLTGMLLGVSETARYGGLTVGPYVINEDVKRRMKEAAEKVRSGEFAKEWIAEYQRGAPR
LRELLEQVSNSQVERVGEFLRQLMRSK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggctaggatatacaaagatggggatgcggatctatcggtgataaggggtaaggtagtg
gctgtgcttggttacggcattcagggtagggcgtgggccttaaacatgagggatagtggt
gtcaaggtcattgttggcgtcaggcctggcaagagctttgacctggctcggcaggagggc
tttgaggtctacccagtgggtgatgcggttaggagggccgacataatagcggtcctacta
cccgatatggtacagccaagtgtttgggggtctgagatcgcgccgggccttaggcgtggc
atgactgtggtgtttgcccatggcttcaacattaggtttgggttaataaggccgccaagt
gatgtggacgtagtcctaatagcgcccaaagccccaggtaaggccgttagggatgagttc
gttaggggttggggagtcccggcactcgtcgcagttcaccaggacttcacggggagtgcc
ctgaagacggcattggcgattgccaaggccaatgggttcacgagagtgggtgtaatagag
acgaccttcgccgaggagacggagaccgacctaatcggtgagcagaacgtgcttgttggc
gggctactgcagttgttgaggtatggttttgaggttatggtggagctcggttaccaacct
gaggtggcttacttcgaggccattaatgaggctaagctaataatggacctgatatgggag
aggggactcactgggatgcttctaggtgttagtgagactgccaggtacggtggcttgacg
gttgggccgtacgtaattaatgaggatgttaagaggaggatgaaggaggctgccgagaag
gttagaagtggcgaatttgctaaggagtggattgcggagtatcagaggggtgcgccaagg
ctcagggagttacttgagcaggttagtaatagccaggttgagagggttggcgagttccta
aggcagttaatgagaagcaagtaa

DBGET integrated database retrieval system