KEGG   Vulcanisaeta distributa: Vdis_1254Help
Entry
Vdis_1254         CDS       T01313                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vdi  Vulcanisaeta distributa
Pathway
vdi00010  Glycolysis / Gluconeogenesis
vdi00051  Fructose and mannose metabolism
vdi00562  Inositol phosphate metabolism
vdi01100  Metabolic pathways
vdi01110  Biosynthesis of secondary metabolites
vdi01120  Microbial metabolism in diverse environments
vdi01130  Biosynthesis of antibiotics
vdi01200  Carbon metabolism
vdi01230  Biosynthesis of amino acids
Module
vdi_M00002  Glycolysis, core module involving three-carbon compounds
vdi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vdi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Vdis_1254
   00051 Fructose and mannose metabolism
    Vdis_1254
   00562 Inositol phosphate metabolism
    Vdis_1254
Enzymes [BR:vdi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Vdis_1254
Exosome [BR:vdi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Vdis_1254
  Exosomal proteins of bladder cancer cells
   Vdis_1254
  Exosomal proteins of melanoma cells
   Vdis_1254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG IGPS His_biosynth Trp_syntA NMO FMN_dh NanE DHO_dh
Motif
Other DBs
NCBI-ProteinID: ADN50640
UniProt: E1QRE3
Position
1192234..1192905
Genome map
AA seq 223 aa AA seqDB search
MKLPILIINMKVYPEVLGKRALELAKVAEAVSRELGVSIAVAPPITELRLVAENVGIPVY
AQGADPVEPGARTGHVPPEFIKEAGASGVILNHSENRLLLNDLGWLVNRAKNLGLETLVC
APDPYTSAAAAALEPTAVAVEPPELIGTGKAVSREKPDVIVKTVELVKRVNPSIPVITGA
GIESYEDVKRAVELGTQGVLVASAIVKARDWRQKIMELAKALH
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaccaatattaatcataaacatgaaagtgtaccctgaggtgctcggtaagagg
gctcttgagcttgctaaggtcgctgaagctgtgtccagggagttaggtgtgtccattgcc
gttgccccaccaattactgagcttaggcttgtggctgagaacgtgggaatacccgtgtat
gcccagggtgctgatccagttgagcctggggctaggacagggcatgtaccgcctgagttc
attaaggaggccggggcgtcgggagtaatacttaatcacagcgagaataggctcctccta
aatgaccttggctggctcgttaacagggcgaagaacctcggcctagagactctcgtgtgt
gcgccggacccatacacgagcgcggctgccgctgcccttgagccaacggcagtagcagtt
gagccacccgagcttattggcactggtaaggccgtaagtagggagaagcctgacgtcatt
gtgaaaaccgtggaactcgttaaaagagttaacccgagcattccggtcatcacgggggcc
ggtattgagagctatgaggatgttaaaagggccgttgaacttgggacacagggagtcctg
gtagctagtgccattgttaaggcgagggattggagacagaagattatggagttagccaaa
gcattacattaa

DBGET integrated database retrieval system