KEGG   Veillonella dispar: NCTC11831_00612Help
Entry
NCTC11831_00612   CDS       T05848                                 

Gene name
mtnW
Definition
(GenBank) 2,3-diketo-5-methylthiopentyl-1-phosphate enolase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
vdn  Veillonella dispar
Pathway
vdn00630  Glyoxylate and dicarboxylate metabolism
vdn01100  Metabolic pathways
vdn01110  Biosynthesis of secondary metabolites
vdn01120  Microbial metabolism in diverse environments
vdn01130  Biosynthesis of antibiotics
vdn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vdn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NCTC11831_00612 (mtnW)
Enzymes [BR:vdn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     NCTC11831_00612 (mtnW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large
Motif
Other DBs
NCBI-ProteinID: VEG93188
Position
1:657308..658498
Genome map
AA seq 396 aa AA seqDB search
MKDERFIVTYRIEASSYEEAKAIAWAVQVEQTIEFPYEFVTDPYIKGTITGRLESLEPMK
QDSAYVNVGVMPNAVIDISRYYVARISYLVDSTALEATQFLNVVFGNSSLQPHIWVVDVE
LCPTLYDVFKGPRFGLHGIRQLVETPTRPMIQAVVKPMGTPNEELARMCGAYTRGGADVI
KDDHGISNQSFSQFKDRVKRCAAIVREMNDKHGTHTLYAANVSGDGTDVIERAYFAKEAG
ATALMVASGLVGFGWLHKLASDEKLQLPIIHHPAYSGGFVSPGTSGIADYLQLGLLPRIF
GADMPIFVSYGGRFTFTEEQCKRISNYIKQPMALMKAACPAPGGGVTDARLNELVKLYGN
DTMFLVGGDMFRRGPDIESNMAYFVERLTDLSESKS
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgagcgatttatagttacgtatcgaatagaagcaagttcatatgaagaggca
aaagctattgcgtgggctgttcaagtagaacaaaccatagagtttccttatgagtttgtc
acagatccatatattaaaggaaccattactggtcgattagaatctcttgaaccgatgaaa
caggattctgcatatgttaatgttggtgtcatgccaaatgctgttatcgatatatctcgt
tactatgtggctcgtatttcatatcttgtagatagtactgccttagaagcaacgcaattt
ttaaatgttgtctttggaaactcgtccttacaacctcatatttgggtggtagatgttgaa
ttatgcccaactctttacgatgtgtttaaaggaccacgttttggtttgcatgggattcgc
caactagtggaaacaccaacgcgtcctatgattcaagccgttgtaaaacctatggggaca
cctaatgaagagctagctcgtatgtgtggtgcttatacacgtggtggggcagatgtcatt
aaggatgaccatggtatttctaatcagtcattctctcaatttaaagatcgggtaaagcga
tgtgctgctatagtgcgtgaaatgaatgataaacacggcacacataccttatatgcagct
aatgtgtctggcgatggtacagacgtaatagaacgtgcttattttgctaaggaagctggc
gcaacggctcttatggtggcctcagggctcgttgggtttggttggctacataaactagct
agtgatgaaaaattacaattgcccattatacaccatcccgcttattcaggtggatttgta
agtcctggcacatctggtatagctgattatctacaattaggcttgttacctcgtattttt
ggggctgatatgccaatctttgtatcctatggtggacgatttactttcacagaggagcaa
tgtaagagaatttcgaattatattaaacaacctatggcattgatgaaagcggcttgccca
gctccaggtggtggtgtaacagatgctcgtcttaatgaactagttaagttgtatggcaat
gatacgatgttcctcgttgggggcgatatgttccgtagaggtccggatatcgagtctaat
atggcttactttgtagagcgtttgactgacttatctgaaagtaagtcataa

DBGET integrated database retrieval system