KEGG   Veillonella dispar: NCTC11831_01607Help
Entry
NCTC11831_01607   CDS       T05848                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
vdn  Veillonella dispar
Pathway
vdn03010  Ribosome
Brite
KEGG Orthology (KO) [BR:vdn00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    NCTC11831_01607 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:vdn03011]
    NCTC11831_01607 (rplV)
Ribosome [BR:vdn03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    NCTC11831_01607 (rplV)
  Bacteria
    NCTC11831_01607 (rplV)
  Archaea
    NCTC11831_01607 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 SpoIISB_antitox
Motif
Other DBs
NCBI-ProteinID: VEG94142
Position
1:complement(1671375..1671710)
Genome map
AA seq 111 aa AA seqDB search
MEAKAIARHIRIAPRKIRIVADLVRGKNIGEAFAILKFTPKVGADVVEKVMRSAIANAEH
NFDMNVDNLYVSEIFVDQGPTLKRIHPRSRGQAFKILKRTSHVTVVVKERA
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaaagcaatcgctagacatatccgaatcgcgcctcgtaaaatccgtatcgtt
gcagatttagtgcgcggtaaaaacatcggcgaagcatttgccatcttgaagttcactccg
aaagttggcgctgatgtagtagaaaaagttatgcgttctgcaatcgcaaacgctgaacat
aatttcgatatgaatgttgacaatctttacgtatccgagatcttcgttgatcaaggccct
acattaaaacgcattcatcctcgttcccgtggtcaagctttcaaaattttgaaacgcact
agccatgtaacagtagtagttaaagaaagagcttaa

DBGET integrated database retrieval system